Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   115016
Name   oriT_pLC2029 in_silico
Organism   Lactobacillus crispatus 2029
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP079207 (6541..6569 [-], 29 nt)
oriT length   29 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 29 nt

>oriT_pLC2029
CGTGGGGTCAGATTTCCCTTATGCTCTTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   9613 GenBank   WP_005728411
Name   Rep_trans_N580_RS12865_pLC2029 insolico UniProt ID   K1MGM6
Length   262 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 262 a.a.        Molecular weight: 31750.25 Da        Isoelectric Point: 9.5904

>WP_005728411.1 MULTISPECIES: replication initiation factor domain-containing protein [Bacteria]
MNTPAGQWLLREIIAKIQNKHYSRCDVAFDIYNDSEIQYYQVWRWGMTKKFFYGKNGELQTVYFGARSSE
RQIRLYNKKIEQEQRHGRIVNVDSLWRLEMQLRGSKIENYVQEVREMLENFYLPDWDHEENLNRQMMIYA
LVHNPEFYSKASRASKQRYRKMIYEAKKSNRVSKILAKEFVNQFDILEGTLQKMMQRYHARNVEVKEIER
DKEPVEYSQELIFRVKKYREIGKSTREIASTLGILVENVEEILELKNRNFDN

  Protein domains


Predicted by InterproScan.

(33-117)


  Protein structure


Source ID Structure
AlphaFold DB K1MGM6


Host bacterium


ID   15451 GenBank   NZ_CP079207
Plasmid name   pLC2029 Incompatibility group   -
Plasmid size   16663 bp Coordinate of oriT [Strand]   6541..6569 [-]
Host baterium   Lactobacillus crispatus 2029

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21