Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114815
Name   oriT_pJF3A-223-3 in_silico
Organism   Enterococcus faecalis strain JF3A-223
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP102067 (64521..64566 [+], 46 nt)
oriT length   46 nt
IRs (inverted repeats)     _
Location of nic site      34..35
Conserved sequence flanking the
  nic site    		  GCTTGCAAAA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 46 nt

>oriT_pJF3A-223-3
AATATCGCAACATGGTACCATGTTGCTCCGCTTGCAAAAAGAAAGC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   5574 GenBank   WP_002367696
Name   WP_002367696_pJF3A-223-3 insolico UniProt ID   Q82YL4
Length   118 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 118 a.a.        Molecular weight: 14042.10 Da        Isoelectric Point: 9.9724

>WP_002367696.1 MULTISPECIES: plasmid mobilization relaxosome protein MobC [Bacteria]
MENKQKLKRPIQRKIRFSKEENELINRKIEESFFPNFQNFALHLLIQGEIRHVDYSELNRLTTEIHKIGI
NINQMARLANQFHEISSEDIKDLTDKVQSLNALVQSELNKLIKRKEQS

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(64-105)


  Protein structure


Source ID Structure
AlphaFold DB Q82YL4


T4CP

ID   11057 GenBank   WP_256969943
Name   t4cp2_NP947_RS14360_pJF3A-223-3 insolico UniProt ID   _
Length   609 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 609 a.a.        Molecular weight: 70203.17 Da        Isoelectric Point: 6.0620

>WP_256969943.1 VirD4-like conjugal transfer protein, CD1115 family [Enterococcus faecalis]
MQTYKKELKPYLYLGVFLFVIGFGIGNFFWLLPGTDYFSKTNYLFTKDILTYIEQTFYRFFITPSLLGFS
VGILDFLLGLLMYVRDNDRGIYRHGEEYGSARFATPAEMKKYEDPLPENNIIVSKHVKISLFNKRLPIKL
QKNKNIAILGDSGAAKTLAFIKTNLMQRHASFITTDPDGGILPEIGLLLKKGKYKIKVLDLNTLSNSDTF
NVFEYMHSELDVDRVLEAVTEATKEVEKTTGDDFWIKAEGLLVRSLIAYLWFDGRRNDYTPHLGMIADML
RHLKRKDKNVPSPVEEWFEELNEAIPDNYAYRQWTLFNNLYESETRASVLGIAAARYSVFDHEEVVNMIR
TDTMDIDSWNEEKTAVFIAIPETNTSFNFIAALMFATVGEVLRNKSDQVRLGKRVLEEGKELLHVRFLID
EFANIGRIPHFEKMLTTFRKREMSFTIVLQSLNQLQTLYRNGWQNILNGCACLLYLGGDEEETTKYLSAR
AGKQTLSIRKHSMNKGNQGGGSENRDKYGRDLIDRSEVALIGGDECLVFISKEHVFKDKKFYAFQHDRAD
ELATGPTDDKWYTWRRYMTDEEAILDKISATDIIDHGEITSELKDETHV

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(144-558)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 43160..61876

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP947_RS14245 38275..38655 + 381 WP_002415096 hypothetical protein -
NP947_RS14250 39226..39531 + 306 WP_002375285 hypothetical protein -
NP947_RS14255 39542..42214 + 2673 WP_256969932 surface exclusion protein SEA1/PrgA -
NP947_RS14260 42292..42486 + 195 WP_002415094 hypothetical protein -
NP947_RS14265 42759..42948 + 190 Protein_46 hypothetical protein -
NP947_RS14270 43160..47050 + 3891 WP_256969934 LPXTG-anchored aggregation substance Asa1 prgB
NP947_RS14275 47112..47468 + 357 WP_002367672 pheromone response system RNA-binding regulator PrgU -
NP947_RS14280 47496..48353 + 858 WP_002367673 pheromone response LPXTG-anchored adhesin PrgC prgC
NP947_RS14285 48395..49294 + 900 WP_002415351 hypothetical protein -
NP947_RS14290 49314..49748 + 435 WP_002365857 hypothetical protein -
NP947_RS14295 49795..50022 + 228 WP_002365858 hypothetical protein -
NP947_RS14300 50035..50331 + 297 WP_002405100 hypothetical protein -
NP947_RS14305 50346..51146 + 801 WP_002414678 type IV secretion system protein prgHb
NP947_RS14310 51148..51501 + 354 WP_002367919 PrgI family mobile element protein prgIc
NP947_RS14315 51455..53845 + 2391 WP_002415350 VirB4-like conjugal transfer ATPase, CD1110 family virb4
NP947_RS14320 53857..56472 + 2616 WP_002415348 phage tail tip lysozyme prgK
NP947_RS14325 56496..57122 + 627 WP_002399631 hypothetical protein prgL
NP947_RS14330 57124..57354 + 231 WP_227660684 type III secretion system protein PrgM -
NP947_RS14335 57338..57946 + 609 WP_002415347 hypothetical protein -
NP947_RS14340 58060..58815 + 756 WP_002415346 Fic family protein -
NP947_RS14345 58832..59290 + 459 WP_002415345 single-stranded DNA-binding protein -
NP947_RS14350 59336..59533 + 198 WP_002415344 hypothetical protein -
NP947_RS14355 59562..60047 + 486 WP_002386493 PcfB family protein gbs1365
NP947_RS14360 60047..61876 + 1830 WP_256969943 VirD4-like conjugal transfer protein, CD1115 family virb4
NP947_RS14365 61927..64086 + 2160 WP_002415219 ArdC-like ssDNA-binding domain-containing protein -
NP947_RS14370 64119..64391 + 273 WP_002415218 LtrD -

Host bacterium

ID   15250 GenBank   NZ_CP102067
Plasmid name   pJF3A-223-3 Incompatibility group   -
Plasmid size   64566 bp Coordinate of oriT [Strand]   64521..64566 [+]
Host baterium   Enterococcus faecalis strain JF3A-223

Cargo genes

Drug resistance gene   -
Virulence gene   asa1
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA9