Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114800
Name   oriT_147_1_TBG_A|plas2 in_silico
Organism   Escherichia albertii strain 147_1_TBG_A
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP099900 (5727..5827 [+], 101 nt)
oriT length   101 nt
IRs (inverted repeats)      32..38, 43..49  (TTACGAT..ATCGTAA)
 21..26, 38..43  (TTTTCA..TGAAAA)
Location of nic site      62..63
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 101 nt

>oriT_147_1_TBG_A|plas2
AATTAGGATAATTTGTTTTGTTTTCAAGCATTTACGATGAAAATCGTAATTGCGTATGGTGTATAGCCGTTAAGGGATACCATACCACGCCTTTTTTAAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   9485 GenBank   WP_256879687
Name   mobF_NIZ13_RS23670_147_1_TBG_A|plas2 insolico UniProt ID   _
Length   295 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 295 a.a.        Molecular weight: 33330.35 Da        Isoelectric Point: 7.5115

>WP_256879687.1 MobF family relaxase [Escherichia albertii]
MLNITTITRQSACDKVVDYYADGADDYYAKDGNAMQWQGAGAEELGLTGEVEQKRFAKLLDGKVTDDISV
MRKTANSESKERLGYDLTFSAPKGVTLQALVNGDKRIIEAHDRAVTKAIEEAERLALGRFTVNKKTHVEN
TNKLIVGKFRHETSRELDPDLHTHAFVMNLTKTSDGKWRSLTNDGIVNSLTLLGNVYKSELARELELAGY
NLRYDRNGTFDLAHFSQEQIAQFSQRSQQIEAELAKNGLSRETASHEQKNAAALKTRKSKGEVDRDVLYE
GWKNRAKELQIWTWR

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(16-288)


  Protein structure



No available structure.




T4CP

ID   11040 GenBank   WP_001001035
Name   t4cp2_NIZ13_RS23675_147_1_TBG_A|plas2 insolico UniProt ID   _
Length   525 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 525 a.a.        Molecular weight: 59019.93 Da        Isoelectric Point: 9.5507

>WP_001001035.1 MULTISPECIES: type IV secretion system DNA-binding domain-containing protein [Enterobacterales]
MNEADKGKICLGALLFTPLVTWFIAAKTLYGFTPKDARERLVLLIQQTFDLWPLWGALLVGEIIAIIGLI
IFFKFNHQIFKGAPFKKIYRGTRLVSQRALASLTKEREPQITIADIPIPTKAEGTHISIAGATGVGKSTI
FAEMMKGCLMRGKMQRVASKKDRMIILDPDGDFLSRFYKKGDKILNPYDARTEGWVFFNEIKSDFDFERF
GVSIVPTAKDSQTEEWNGYGRLLFTEVSRKVFNTSRNPTMEEVFYWTNEVPLEELEEYVRGTKAQALFAG
SGRAVGSARFVLSNKLAAHLKMPAGNFSIREWLEDPKGGNLYITWTDEMREALKSLISCWTDSIFSIVLG
MSKSNTRKIWTYIDELESLDYLPSLRDALTKGRKKGLRVVTGYQSYSQVISIYGSDVAETLLSNHRTSVV
MAAGRLGERTLEFVSKSLGEIEGEREKTGISRRFGQMGTKNINDDHKRERAVTPTEIATLDDLTGYIAFP
GNLPVAKFETHHVNYTRSNPVPGVVLRESTAFAGM

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(111-499)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 22136..33942

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ13_RS23785 (NIZ13_23770) 17788..18372 - 585 WP_000690619 recombinase family protein -
NIZ13_RS23790 (NIZ13_23775) 18372..18794 - 423 WP_061090063 hypothetical protein -
NIZ13_RS23795 (NIZ13_23780) 19259..19504 + 246 WP_000195442 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NIZ13_RS23800 (NIZ13_23785) 19504..20046 + 543 WP_000711249 hypothetical protein -
NIZ13_RS23805 (NIZ13_23790) 20016..20312 + 297 WP_226331936 hypothetical protein -
NIZ13_RS23810 (NIZ13_23795) 20302..20628 + 327 WP_000817647 endoribonuclease MazF -
NIZ13_RS23815 (NIZ13_23800) 20654..20968 + 315 WP_001280992 hypothetical protein -
NIZ13_RS24865 21028..21429 - 402 WP_015345245 Hha/YmoA family nucleoid-associated regulatory protein -
NIZ13_RS23825 (NIZ13_23810) 21573..22160 - 588 WP_256879679 restriction endonuclease -
NIZ13_RS23830 (NIZ13_23815) 22136..22450 - 315 WP_000851068 hypothetical protein tfc15
NIZ13_RS23835 (NIZ13_23820) 22453..22677 - 225 WP_239534999 TrbM/KikA/MpfK family conjugal transfer protein -
NIZ13_RS23840 (NIZ13_23825) 22780..23217 - 438 WP_000034608 hypothetical protein -
NIZ13_RS23845 (NIZ13_23830) 23229..23465 - 237 WP_000089855 H-NS family nucleoid-associated regulatory protein -
NIZ13_RS23850 (NIZ13_23835) 23528..24196 + 669 WP_256879680 lytic transglycosylase domain-containing protein virB1
NIZ13_RS23855 (NIZ13_23840) 24290..24607 + 318 WP_001267114 hypothetical protein -
NIZ13_RS23860 (NIZ13_23845) 24698..24880 + 183 WP_256879681 TrbC/VirB2 family protein virB2
NIZ13_RS23865 (NIZ13_23850) 24930..25190 + 261 WP_256879682 VirB3 family type IV secretion system protein virB3
NIZ13_RS23870 (NIZ13_23855) 25242..26684 + 1443 WP_256879683 hypothetical protein virb4
NIZ13_RS23875 (NIZ13_23860) 26700..27872 + 1173 WP_252363867 AAA family ATPase virb4
NIZ13_RS23880 (NIZ13_23865) 27882..28589 + 708 WP_036896352 type IV secretion system protein virB5
NIZ13_RS23885 (NIZ13_23870) 28593..28829 + 237 WP_000733633 EexN family lipoprotein -
NIZ13_RS23890 (NIZ13_23875) 29186..29893 + 708 Protein_47 type IV secretion system protein -
NIZ13_RS23895 (NIZ13_23880) 29988..30158 + 171 WP_021536809 hypothetical protein -
NIZ13_RS23900 (NIZ13_23885) 30161..30877 + 717 WP_000914645 virB8 family protein virB8
NIZ13_RS23905 (NIZ13_23890) 30880..31767 + 888 WP_000744355 TrbG/VirB9 family P-type conjugative transfer protein virB9
NIZ13_RS23910 (NIZ13_23895) 31764..32918 + 1155 WP_001224296 type IV secretion system protein VirB10 virB10
NIZ13_RS23915 (NIZ13_23900) 32911..33942 + 1032 WP_000138004 P-type DNA transfer ATPase VirB11 virB11
NIZ13_RS23920 (NIZ13_23905) 33905..34459 + 555 WP_000616063 phospholipase D family protein -

Host bacterium

ID   15235 GenBank   NZ_CP099900
Plasmid name   147_1_TBG_A|plas2 Incompatibility group   -
Plasmid size   34480 bp Coordinate of oriT [Strand]   5727..5827 [+]
Host baterium   Escherichia albertii strain 147_1_TBG_A

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -