Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 114798 |
Name | oriT_254_1_EW_B|plas1 |
Organism | Escherichia albertii strain 254_1_EW_B |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP099869 (40220..40343 [-], 124 nt) |
oriT length | 124 nt |
IRs (inverted repeats) | 101..106, 119..124 (TTTAAT..ATTAAA) 91..99, 113..121 (AATAATGTA..TACATTATT) 90..95, 107..112 (AAATAA..TTATTT) 88..93, 105..110 (ATAAAT..ATTTAT) 41..48, 61..68 (AAAAACAA..TTGTTTTT) 39..46, 49..56 (GCAAAAAC..GTTTTTGC) 3..10, 15..22 (TTGGTGGT..ACCACCAA) |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 124 nt
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTGAATCATTAGCTTATGTTATAAATAATGTATTTTAATTTATTTTACATTATTAAA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileAuxiliary protein
ID | 5561 | GenBank | WP_001254385 |
Name | WP_001254385_254_1_EW_B|plas1 | UniProt ID | A0A1Q9L2K4 |
Length | 75 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 75 a.a. Molecular weight: 8975.08 Da Isoelectric Point: 10.1422
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVAEESES
TFKEL
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q9L2K4 |
ID | 5562 | GenBank | WP_000124979 |
Name | WP_000124979_254_1_EW_B|plas1 | UniProt ID | Q5JBL6 |
Length | 127 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14456.50 Da Isoelectric Point: 5.2973
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECAVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFFPKNDGE
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5JBL6 |
T4CP
ID | 11036 | GenBank | WP_153449148 |
Name | traD_NIZ25_RS23575_254_1_EW_B|plas1 | UniProt ID | _ |
Length | 738 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 738 a.a. Molecular weight: 83934.58 Da Isoelectric Point: 5.0504
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYE
AWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
ID | 11037 | GenBank | WP_001064248 |
Name | traC_NIZ25_RS23665_254_1_EW_B|plas1 | UniProt ID | _ |
Length | 875 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 875 a.a. Molecular weight: 99269.03 Da Isoelectric Point: 6.1932
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNRARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 14190..40915
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ25_RS23575 (NIZ25_23555) | 14190..16406 | - | 2217 | WP_153449148 | type IV conjugative transfer system coupling protein TraD | virb4 |
NIZ25_RS23580 (NIZ25_23560) | 16659..17390 | - | 732 | WP_000850424 | conjugal transfer complement resistance protein TraT | - |
NIZ25_RS23585 (NIZ25_23565) | 17422..17925 | - | 504 | WP_000605510 | hypothetical protein | - |
NIZ25_RS23590 (NIZ25_23570) | 17940..20762 | - | 2823 | WP_011251382 | conjugal transfer mating-pair stabilization protein TraG | traG |
NIZ25_RS23595 (NIZ25_23575) | 20759..22132 | - | 1374 | WP_001137358 | conjugal transfer pilus assembly protein TraH | traH |
NIZ25_RS23600 (NIZ25_23580) | 22132..22494 | - | 363 | WP_001443292 | P-type conjugative transfer protein TrbJ | - |
NIZ25_RS23605 (NIZ25_23585) | 22424..22969 | - | 546 | WP_000059847 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
NIZ25_RS23610 (NIZ25_23590) | 22956..23240 | - | 285 | WP_000624109 | type-F conjugative transfer system pilin chaperone TraQ | - |
NIZ25_RS23615 (NIZ25_23595) | 23359..23706 | - | 348 | WP_001287895 | conjugal transfer protein TrbA | - |
NIZ25_RS23620 (NIZ25_23600) | 23722..24465 | - | 744 | WP_001030376 | type-F conjugative transfer system pilin assembly protein TraF | traF |
NIZ25_RS23625 (NIZ25_23605) | 24458..24715 | - | 258 | WP_000864325 | conjugal transfer protein TrbE | - |
NIZ25_RS23630 (NIZ25_23610) | 24742..26550 | - | 1809 | WP_000821818 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
NIZ25_RS23635 (NIZ25_23615) | 26547..27185 | - | 639 | WP_001104248 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
NIZ25_RS23640 (NIZ25_23620) | 27213..27665 | - | 453 | WP_000069427 | hypothetical protein | - |
NIZ25_RS23645 (NIZ25_23625) | 27695..28156 | - | 462 | WP_000277845 | hypothetical protein | - |
NIZ25_RS23650 (NIZ25_23630) | 28182..29174 | - | 993 | WP_000830839 | conjugal transfer pilus assembly protein TraU | traU |
NIZ25_RS23655 (NIZ25_23635) | 29171..29803 | - | 633 | WP_001203745 | type-F conjugative transfer system protein TraW | traW |
NIZ25_RS23660 (NIZ25_23640) | 29800..30186 | - | 387 | WP_000214096 | type-F conjugative transfer system protein TrbI | - |
NIZ25_RS23665 (NIZ25_23645) | 30183..32810 | - | 2628 | WP_001064248 | type IV secretion system protein TraC | virb4 |
NIZ25_RS23670 (NIZ25_23650) | 32970..33191 | - | 222 | WP_001278689 | conjugal transfer protein TraR | - |
NIZ25_RS23675 (NIZ25_23655) | 33325..33840 | - | 516 | WP_000809906 | type IV conjugative transfer system lipoprotein TraV | traV |
NIZ25_RS23680 (NIZ25_23660) | 33837..34088 | - | 252 | WP_001038341 | conjugal transfer protein TrbG | - |
NIZ25_RS23685 (NIZ25_23665) | 34085..34402 | - | 318 | WP_001057292 | conjugal transfer protein TrbD | virb4 |
NIZ25_RS23690 (NIZ25_23670) | 34399..34971 | - | 573 | WP_000002794 | conjugal transfer pilus-stabilizing protein TraP | - |
NIZ25_RS23695 (NIZ25_23675) | 34961..36388 | - | 1428 | WP_000146685 | F-type conjugal transfer pilus assembly protein TraB | traB |
NIZ25_RS23700 (NIZ25_23680) | 36388..37116 | - | 729 | WP_001230787 | type-F conjugative transfer system secretin TraK | traK |
NIZ25_RS23705 (NIZ25_23685) | 37103..37669 | - | 567 | WP_000399792 | type IV conjugative transfer system protein TraE | traE |
NIZ25_RS23710 (NIZ25_23690) | 37691..38002 | - | 312 | WP_000012106 | type IV conjugative transfer system protein TraL | traL |
NIZ25_RS23715 (NIZ25_23695) | 38017..38376 | - | 360 | WP_000340272 | type IV conjugative transfer system pilin TraA | - |
NIZ25_RS23720 (NIZ25_23700) | 38410..38637 | - | 228 | WP_001254385 | conjugal transfer relaxosome protein TraY | - |
NIZ25_RS23725 (NIZ25_23705) | 38731..39417 | - | 687 | WP_000332493 | PAS domain-containing protein | - |
NIZ25_RS23730 (NIZ25_23710) | 39608..39991 | - | 384 | WP_000124979 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NIZ25_RS23735 (NIZ25_23715) | 40268..40915 | + | 648 | WP_256876177 | transglycosylase SLT domain-containing protein | virB1 |
NIZ25_RS23740 (NIZ25_23720) | 41212..42033 | - | 822 | WP_001234469 | DUF932 domain-containing protein | - |
NIZ25_RS23745 (NIZ25_23725) | 42153..42440 | - | 288 | WP_000107535 | hypothetical protein | - |
NIZ25_RS23750 (NIZ25_23730) | 42465..42671 | - | 207 | WP_000547971 | hypothetical protein | - |
NIZ25_RS23755 (NIZ25_23735) | 42741..42914 | + | 174 | Protein_48 | hypothetical protein | - |
NIZ25_RS23760 (NIZ25_23740) | 42912..43142 | - | 231 | WP_256876178 | hypothetical protein | - |
NIZ25_RS23765 (NIZ25_23745) | 43362..43487 | - | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
NIZ25_RS23770 (NIZ25_23750) | 43429..43578 | - | 150 | Protein_51 | plasmid maintenance protein Mok | - |
NIZ25_RS23775 (NIZ25_23755) | 43600..43788 | + | 189 | WP_001299721 | hypothetical protein | - |
NIZ25_RS23780 (NIZ25_23760) | 43757..44519 | - | 763 | Protein_53 | plasmid SOS inhibition protein A | - |
NIZ25_RS23785 (NIZ25_23765) | 44516..44950 | - | 435 | WP_000845873 | conjugation system SOS inhibitor PsiB | - |
Host bacterium
ID | 15233 | GenBank | NZ_CP099869 |
Plasmid name | 254_1_EW_B|plas1 | Incompatibility group | IncFII |
Plasmid size | 105541 bp | Coordinate of oriT [Strand] | 40220..40343 [-] |
Host baterium | Escherichia albertii strain 254_1_EW_B |
Cargo genes
Drug resistance gene | - |
Virulence gene | espL2 |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |