Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114796
Name   oriT_133_1_GWG_A|plas2 in_silico
Organism   Escherichia albertii strain 133_1_GWG_A
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP099905 (89005..89071 [-], 67 nt)
oriT length   67 nt
IRs (inverted repeats)      42..49, 54..61  (TTGGTGGT..ACCACCAA)
 8..15, 18..25  (GCAAAAAC..GTTTTTGC)
Location of nic site      34..35
Conserved sequence flanking the
  nic site    		  GGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 67 nt

>oriT_133_1_GWG_A|plas2
CAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   5558 GenBank   WP_001254385
Name   WP_001254385_133_1_GWG_A|plas2 insolico UniProt ID   A0A1Q9L2K4
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 8975.08 Da        Isoelectric Point: 10.1422

>WP_001254385.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Enterobacteriaceae]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVAEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A1Q9L2K4


T4CP

ID   11032 GenBank   WP_001064248
Name   traC_NIY95_RS24575_133_1_GWG_A|plas2 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99269.03 Da        Isoelectric Point: 6.1932

>WP_001064248.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKNRARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.



ID   11033 GenBank   WP_153449148
Name   traD_NIY95_RS24665_133_1_GWG_A|plas2 insolico UniProt ID   _
Length   738 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 738 a.a.        Molecular weight: 83934.58 Da        Isoelectric Point: 5.0504

>WP_153449148.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Escherichia]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYE
AWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2278..26091

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY95_RS24510 (NIY95_24480) 285..669 + 385 Protein_1 conjugal transfer relaxosome DNA-binding protein TraM -
NIY95_RS24515 (NIY95_24485) 860..1547 + 688 Protein_2 PAS domain-containing protein -
NIY95_RS24520 (NIY95_24490) 1643..1870 + 228 WP_001254385 conjugal transfer relaxosome protein TraY -
NIY95_RS24525 (NIY95_24495) 1904..2263 + 360 WP_000340272 type IV conjugative transfer system pilin TraA -
NIY95_RS24530 (NIY95_24500) 2278..2589 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
NIY95_RS24535 (NIY95_24505) 2611..3177 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
NIY95_RS24540 (NIY95_24510) 3222..3893 + 672 WP_001340581 type-F conjugative transfer system secretin TraK traK
NIY95_RS24545 (NIY95_24515) 3893..5320 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
NIY95_RS24550 (NIY95_24520) 5310..5882 + 573 WP_000002794 conjugal transfer pilus-stabilizing protein TraP -
NIY95_RS24555 (NIY95_24525) 5879..6196 + 318 WP_001057292 conjugal transfer protein TrbD virb4
NIY95_RS24560 (NIY95_24530) 6193..6444 + 252 WP_001038341 conjugal transfer protein TrbG -
NIY95_RS24565 (NIY95_24535) 6441..6956 + 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
NIY95_RS24570 (NIY95_24540) 7090..7311 + 222 WP_001278689 conjugal transfer protein TraR -
NIY95_RS24575 (NIY95_24545) 7471..10098 + 2628 WP_001064248 type IV secretion system protein TraC virb4
NIY95_RS24580 (NIY95_24550) 10095..10481 + 387 WP_000214096 type-F conjugative transfer system protein TrbI -
NIY95_RS24585 (NIY95_24555) 10478..11110 + 633 WP_001203745 type-F conjugative transfer system protein TraW traW
NIY95_RS24590 (NIY95_24560) 11107..12099 + 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
NIY95_RS24595 (NIY95_24565) 12125..12586 + 462 WP_000277845 hypothetical protein -
NIY95_RS24600 (NIY95_24570) 12616..13068 + 453 WP_000069427 hypothetical protein -
NIY95_RS24605 (NIY95_24575) 13096..13734 + 639 WP_001104248 type-F conjugative transfer system pilin assembly protein TrbC trbC
NIY95_RS24610 (NIY95_24580) 13731..15539 + 1809 WP_000821818 type-F conjugative transfer system mating-pair stabilization protein TraN traN
NIY95_RS24615 (NIY95_24585) 15566..15823 + 258 WP_000864325 conjugal transfer protein TrbE -
NIY95_RS24620 (NIY95_24590) 15816..16559 + 744 WP_001030376 type-F conjugative transfer system pilin assembly protein TraF traF
NIY95_RS24625 (NIY95_24595) 16575..16922 + 348 WP_001287895 conjugal transfer protein TrbA -
NIY95_RS24630 (NIY95_24600) 17041..17325 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
NIY95_RS24635 (NIY95_24605) 17312..17857 + 546 WP_000059847 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
NIY95_RS24640 (NIY95_24610) 17787..18149 + 363 WP_001443292 P-type conjugative transfer protein TrbJ -
NIY95_RS24645 (NIY95_24615) 18149..19522 + 1374 WP_001137358 conjugal transfer pilus assembly protein TraH traH
NIY95_RS24650 (NIY95_24620) 19519..22341 + 2823 WP_011251382 conjugal transfer mating-pair stabilization protein TraG traG
NIY95_RS24655 (NIY95_24625) 22356..22859 + 504 WP_000605510 hypothetical protein -
NIY95_RS24660 (NIY95_24630) 22891..23622 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
NIY95_RS24665 (NIY95_24635) 23875..26091 + 2217 WP_153449148 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   15231 GenBank   NZ_CP099905
Plasmid name   133_1_GWG_A|plas2 Incompatibility group   IncFII
Plasmid size   89077 bp Coordinate of oriT [Strand]   89005..89071 [-]
Host baterium   Escherichia albertii strain 133_1_GWG_A

Cargo genes

Drug resistance gene   -
Virulence gene   espL2
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -