Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114664
Name   oriT_pHN08160-1 in_silico
Organism   Shigella sonnei strain HN08160
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OQ230385 (18022..18094 [+], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_pHN08160-1
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   9404 GenBank   WP_000991384
Name   Relaxase_RA127_RS00090_pHN08160-1 insolico UniProt ID   A0A8H8Z9E5
Length   903 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 903 a.a.        Molecular weight: 104595.99 Da        Isoelectric Point: 7.6377

>WP_000991384.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRIRMGTGPQGAIKRELFSDKESLWGY
TTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVELGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEARLQKDGS
VRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPRMGFEPEGSYQQFNDVFAEMVAW
HNAAGITGSGHFVISRPDVDLHRQRSEQYYHEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure



No available structure.




Auxiliary protein

ID   5515 GenBank   WP_001291058
Name   WP_001291058_pHN08160-1 insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 71901..102507

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RA127_RS00390 (pHN08160-1_00075) 67969..68382 + 414 WP_124983997 type IV pilus biogenesis protein PilM -
RA127_RS00395 (pHN08160-1_00076) 68414..70033 + 1620 WP_001035565 PilN family type IVB pilus formation outer membrane protein -
RA127_RS00400 (pHN08160-1_00077) 70054..71349 + 1296 WP_000129882 type 4b pilus protein PilO2 -
RA127_RS00405 (pHN08160-1_00078) 71339..71797 + 459 WP_000095885 type IV pilus biogenesis protein PilP -
RA127_RS00410 (pHN08160-1_00079) 71901..73409 + 1509 WP_000880805 GspE/PulE family protein virB11
RA127_RS00415 (pHN08160-1_00080) 73411..74040 + 630 WP_305847063 type II secretion system F family protein -
RA127_RS00425 (pHN08160-1_00083) 75368..75772 + 405 WP_305847064 type II secretion system F family protein -
RA127_RS00430 (pHN08160-1_00084) 75834..76370 + 537 WP_000111534 type 4 pilus major pilin -
RA127_RS00435 (pHN08160-1_00085) 76415..76900 + 486 WP_001080767 lytic transglycosylase domain-containing protein virB1
RA127_RS00440 (pHN08160-1_00086) 76916..77041 + 126 WP_005082523 hypothetical protein -
RA127_RS00445 (pHN08160-1_00087) 77041..77541 + 501 WP_001330556 prepilin peptidase -
RA127_RS00450 (pHN08160-1_00088) 77559..78920 + 1362 WP_001168171 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
RA127_RS00455 79034..79228 + 195 Protein_90 integrase -
RA127_RS00460 (pHN08160-1_00089) 79393..80214 + 822 WP_000845373 hypothetical protein traE
RA127_RS00465 (pHN08160-1_00090) 80316..81518 + 1203 WP_000979993 conjugal transfer protein TraF -
RA127_RS00470 (pHN08160-1_00091) 81622..82080 + 459 WP_001170111 DotD/TraH family lipoprotein -
RA127_RS00475 (pHN08160-1_00092) 82077..82913 + 837 WP_000745049 type IV secretory system conjugative DNA transfer family protein traI
RA127_RS00480 (pHN08160-1_00093) 82897..84045 + 1149 WP_000775210 plasmid transfer ATPase TraJ virB11
RA127_RS00485 (pHN08160-1_00094) 84042..84332 + 291 WP_000817801 IcmT/TraK family protein traK
RA127_RS00490 (pHN08160-1_00095) 84396..88457 + 4062 WP_000842456 LPD7 domain-containing protein -
RA127_RS00495 (pHN08160-1_00096) 88474..88824 + 351 WP_001056367 hypothetical protein traL
RA127_RS00500 (pHN08160-1_00097) 88836..89531 + 696 WP_001287545 DotI/IcmL family type IV secretion protein traM
RA127_RS00505 (pHN08160-1_00098) 89542..90516 + 975 WP_000547386 DotH/IcmK family type IV secretion protein traN
RA127_RS00510 90520..91856 + 1337 Protein_101 conjugal transfer protein TraO -
RA127_RS00515 (pHN08160-1_00101) 91853..92566 + 714 WP_000787002 conjugal transfer protein TraP traP
RA127_RS00520 (pHN08160-1_00102) 92563..93093 + 531 WP_000987021 conjugal transfer protein TraQ traQ
RA127_RS00525 (pHN08160-1_00103) 93140..93538 + 399 WP_000088813 DUF6750 family protein traR
RA127_RS00530 (pHN08160-1_00104) 93595..93846 + 252 WP_001277573 hypothetical protein -
RA127_RS00535 (pHN08160-1_00105) 93761..94579 + 819 WP_000753550 hypothetical protein traT
RA127_RS00540 (pHN08160-1_00106) 94874..97918 + 3045 WP_001024769 conjugal transfer protein traU
RA127_RS00545 (pHN08160-1_00107) 97918..98538 + 621 WP_000286854 hypothetical protein traV
RA127_RS00550 (pHN08160-1_00108) 98496..99701 + 1206 WP_001189547 conjugal transfer protein TraW traW
RA127_RS00555 (pHN08160-1_00109) 99698..100267 + 570 WP_000650752 conjugal transfer protein TraX -
RA127_RS00560 (pHN08160-1_00110) 100342..102507 + 2166 WP_000691812 DotA/TraY family protein traY
RA127_RS00565 (pHN08160-1_00111) 102596..103246 + 651 WP_001044247 plasmid IncI1-type surface exclusion protein ExcA -
RA127_RS00570 (pHN08160-1_00112) 103520..104482 + 963 WP_241381294 sigma factor-like helix-turn-helix DNA-binding protein -
RA127_RS00575 (pHN08160-1_00113) 104593..105105 + 513 WP_001401993 TnsA endonuclease N-terminal domain-containing protein -
RA127_RS00580 105243..105395 - 153 WP_001302699 Hok/Gef family protein -
RA127_RS00585 (pHN08160-1_00115) 105725..105967 + 243 WP_001363144 hypothetical protein -

Host bacterium

ID   15099 GenBank   NZ_OQ230385
Plasmid name   pHN08160-1 Incompatibility group   IncB/O/K/Z
Plasmid size   106233 bp Coordinate of oriT [Strand]   18022..18094 [+]
Host baterium   Shigella sonnei strain HN08160

Cargo genes

Drug resistance gene   sul2, aph(3'')-Ib, aph(6)-Id, tet(A), blaTEM-1B, aac(3)-IId, dfrA12
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -