Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114584
Name   oriT_tig00000003 in_silico
Organism   Enterobacter cloacae complex sp. AR_0002
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP018815 (13713..13761 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_tig00000003
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   5465 GenBank   WP_022644939
Name   WP_022644939_tig00000003 insolico UniProt ID   W8QGP1
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 15048.16 Da        Isoelectric Point: 4.5248

>WP_022644939.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB W8QGP1


T4CP

ID   10844 GenBank   WP_032072078
Name   traD_AM329_RS25050_tig00000003 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85822.78 Da        Isoelectric Point: 4.9615

>WP_032072078.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1374..11336

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM329_RS24195 (AM329_23435) 938..1339 - 402 WP_022644934 hypothetical protein -
AM329_RS24200 (AM329_23440) 1374..2009 - 636 WP_020325113 type-F conjugative transfer system protein TraW traW
AM329_RS24205 (AM329_23445) 2006..2398 - 393 WP_022644935 type-F conjugative transfer system protein TrbI -
AM329_RS24210 (AM329_23450) 2398..5037 - 2640 WP_022644936 type IV secretion system protein TraC virb4
AM329_RS24215 (AM329_23455) 5109..5507 - 399 WP_011977783 hypothetical protein -
AM329_RS26160 (AM329_23460) 5515..5904 - 390 WP_004153076 hypothetical protein -
AM329_RS24225 (AM329_23465) 5947..6351 - 405 WP_004152503 hypothetical protein -
AM329_RS24230 (AM329_23470) 6418..6729 - 312 WP_004152502 hypothetical protein -
AM329_RS24235 (AM329_23475) 6730..6948 - 219 WP_004152501 hypothetical protein -
AM329_RS24240 (AM329_23480) 7054..7464 - 411 WP_004152499 hypothetical protein -
AM329_RS24245 (AM329_23485) 7596..8180 - 585 WP_004161368 type IV conjugative transfer system lipoprotein TraV traV
AM329_RS24250 (AM329_23490) 8294..9718 - 1425 WP_022644937 F-type conjugal transfer pilus assembly protein TraB traB
AM329_RS24255 (AM329_23495) 9718..10458 - 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
AM329_RS24260 (AM329_23500) 10445..11011 - 567 WP_004144423 type IV conjugative transfer system protein TraE traE
AM329_RS24265 (AM329_23505) 11031..11336 - 306 WP_004144424 type IV conjugative transfer system protein TraL traL
AM329_RS24270 (AM329_23510) 11350..11718 - 369 WP_004194426 type IV conjugative transfer system pilin TraA -
AM329_RS24280 (AM329_23515) 12072..12773 - 702 WP_022644938 hypothetical protein -
AM329_RS24285 (AM329_23520) 13008..13400 - 393 WP_022644939 conjugal transfer relaxosome DNA-binding protein TraM -
AM329_RS24290 (AM329_23525) 13846..14328 + 483 WP_022644940 transglycosylase SLT domain-containing protein -
AM329_RS24295 (AM329_23530) 14352..14894 - 543 WP_022644941 antirestriction protein -
AM329_RS26165 15243..15479 - 237 Protein_21 SAM-dependent DNA methyltransferase -
AM329_RS24305 (AM329_23540) 15527..15673 - 147 WP_022644943 hypothetical protein -
AM329_RS24310 (AM329_23545) 15766..16113 - 348 WP_022644944 hypothetical protein -

Region 2: 125332..139881

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM329_RS25050 (AM329_24170) 125332..127644 - 2313 WP_032072078 type IV conjugative transfer system coupling protein TraD virb4
AM329_RS25995 127773..128462 - 690 WP_022644928 hypothetical protein -
AM329_RS25060 (AM329_24180) 128654..129385 - 732 WP_004152622 conjugal transfer complement resistance protein TraT -
AM329_RS25065 (AM329_24185) 129569..130117 - 549 WP_004152623 conjugal transfer entry exclusion protein TraS -
AM329_RS25070 (AM329_24190) 130130..132979 - 2850 WP_004152624 conjugal transfer mating-pair stabilization protein TraG traG
AM329_RS25075 (AM329_24195) 132979..134358 - 1380 WP_075995129 conjugal transfer pilus assembly protein TraH traH
AM329_RS25080 (AM329_24200) 134336..134779 - 444 WP_004194305 F-type conjugal transfer protein TrbF -
AM329_RS25085 (AM329_24205) 134825..135382 - 558 WP_022644930 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
AM329_RS25090 (AM329_24210) 135354..135593 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
AM329_RS25095 (AM329_24215) 135604..136357 - 754 Protein_164 type-F conjugative transfer system pilin assembly protein TraF -
AM329_RS25100 (AM329_24220) 136378..136704 - 327 WP_004152676 hypothetical protein -
AM329_RS25105 (AM329_24225) 136717..136965 - 249 WP_022644931 hypothetical protein -
AM329_RS25110 (AM329_24230) 136943..137197 - 255 WP_004152674 conjugal transfer protein TrbE -
AM329_RS25115 (AM329_24235) 137229..139184 - 1956 WP_022644932 type-F conjugative transfer system mating-pair stabilization protein TraN traN
AM329_RS25120 (AM329_24240) 139243..139881 - 639 WP_022644933 type-F conjugative transfer system pilin assembly protein TrbC trbC

Host bacterium

ID   15019 GenBank   NZ_CP018815
Plasmid name   tig00000003 Incompatibility group   IncFIA
Plasmid size   139942 bp Coordinate of oriT [Strand]   13713..13761 [+]
Host baterium   Enterobacter cloacae complex sp. AR_0002

Cargo genes

Drug resistance gene   dfrA14, sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1A, blaOXA-9, ant(3'')-Ia, aac(6')-Ib, blaKPC-3
Virulence gene   -
Metal resistance gene   ncrA, ncrB, ncrC, ncrY
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -