Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114584 |
| Name | oriT_tig00000003 |
| Organism | Enterobacter cloacae complex sp. AR_0002 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP018815 (13713..13761 [+], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_tig00000003
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 5465 | GenBank | WP_022644939 |
| Name | WP_022644939_tig00000003 |
UniProt ID | W8QGP1 |
| Length | 130 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 130 a.a. Molecular weight: 15048.16 Da Isoelectric Point: 4.5248
>WP_022644939.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W8QGP1 |
T4CP
| ID | 10844 | GenBank | WP_032072078 |
| Name | traD_AM329_RS25050_tig00000003 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85822.78 Da Isoelectric Point: 4.9615
>WP_032072078.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1374..11336
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM329_RS24195 (AM329_23435) | 938..1339 | - | 402 | WP_022644934 | hypothetical protein | - |
| AM329_RS24200 (AM329_23440) | 1374..2009 | - | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| AM329_RS24205 (AM329_23445) | 2006..2398 | - | 393 | WP_022644935 | type-F conjugative transfer system protein TrbI | - |
| AM329_RS24210 (AM329_23450) | 2398..5037 | - | 2640 | WP_022644936 | type IV secretion system protein TraC | virb4 |
| AM329_RS24215 (AM329_23455) | 5109..5507 | - | 399 | WP_011977783 | hypothetical protein | - |
| AM329_RS26160 (AM329_23460) | 5515..5904 | - | 390 | WP_004153076 | hypothetical protein | - |
| AM329_RS24225 (AM329_23465) | 5947..6351 | - | 405 | WP_004152503 | hypothetical protein | - |
| AM329_RS24230 (AM329_23470) | 6418..6729 | - | 312 | WP_004152502 | hypothetical protein | - |
| AM329_RS24235 (AM329_23475) | 6730..6948 | - | 219 | WP_004152501 | hypothetical protein | - |
| AM329_RS24240 (AM329_23480) | 7054..7464 | - | 411 | WP_004152499 | hypothetical protein | - |
| AM329_RS24245 (AM329_23485) | 7596..8180 | - | 585 | WP_004161368 | type IV conjugative transfer system lipoprotein TraV | traV |
| AM329_RS24250 (AM329_23490) | 8294..9718 | - | 1425 | WP_022644937 | F-type conjugal transfer pilus assembly protein TraB | traB |
| AM329_RS24255 (AM329_23495) | 9718..10458 | - | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| AM329_RS24260 (AM329_23500) | 10445..11011 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| AM329_RS24265 (AM329_23505) | 11031..11336 | - | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| AM329_RS24270 (AM329_23510) | 11350..11718 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| AM329_RS24280 (AM329_23515) | 12072..12773 | - | 702 | WP_022644938 | hypothetical protein | - |
| AM329_RS24285 (AM329_23520) | 13008..13400 | - | 393 | WP_022644939 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| AM329_RS24290 (AM329_23525) | 13846..14328 | + | 483 | WP_022644940 | transglycosylase SLT domain-containing protein | - |
| AM329_RS24295 (AM329_23530) | 14352..14894 | - | 543 | WP_022644941 | antirestriction protein | - |
| AM329_RS26165 | 15243..15479 | - | 237 | Protein_21 | SAM-dependent DNA methyltransferase | - |
| AM329_RS24305 (AM329_23540) | 15527..15673 | - | 147 | WP_022644943 | hypothetical protein | - |
| AM329_RS24310 (AM329_23545) | 15766..16113 | - | 348 | WP_022644944 | hypothetical protein | - |
Region 2: 125332..139881
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM329_RS25050 (AM329_24170) | 125332..127644 | - | 2313 | WP_032072078 | type IV conjugative transfer system coupling protein TraD | virb4 |
| AM329_RS25995 | 127773..128462 | - | 690 | WP_022644928 | hypothetical protein | - |
| AM329_RS25060 (AM329_24180) | 128654..129385 | - | 732 | WP_004152622 | conjugal transfer complement resistance protein TraT | - |
| AM329_RS25065 (AM329_24185) | 129569..130117 | - | 549 | WP_004152623 | conjugal transfer entry exclusion protein TraS | - |
| AM329_RS25070 (AM329_24190) | 130130..132979 | - | 2850 | WP_004152624 | conjugal transfer mating-pair stabilization protein TraG | traG |
| AM329_RS25075 (AM329_24195) | 132979..134358 | - | 1380 | WP_075995129 | conjugal transfer pilus assembly protein TraH | traH |
| AM329_RS25080 (AM329_24200) | 134336..134779 | - | 444 | WP_004194305 | F-type conjugal transfer protein TrbF | - |
| AM329_RS25085 (AM329_24205) | 134825..135382 | - | 558 | WP_022644930 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| AM329_RS25090 (AM329_24210) | 135354..135593 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| AM329_RS25095 (AM329_24215) | 135604..136357 | - | 754 | Protein_164 | type-F conjugative transfer system pilin assembly protein TraF | - |
| AM329_RS25100 (AM329_24220) | 136378..136704 | - | 327 | WP_004152676 | hypothetical protein | - |
| AM329_RS25105 (AM329_24225) | 136717..136965 | - | 249 | WP_022644931 | hypothetical protein | - |
| AM329_RS25110 (AM329_24230) | 136943..137197 | - | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| AM329_RS25115 (AM329_24235) | 137229..139184 | - | 1956 | WP_022644932 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| AM329_RS25120 (AM329_24240) | 139243..139881 | - | 639 | WP_022644933 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
Host bacterium
| ID | 15019 | GenBank | NZ_CP018815 |
| Plasmid name | tig00000003 | Incompatibility group | IncFIA |
| Plasmid size | 139942 bp | Coordinate of oriT [Strand] | 13713..13761 [+] |
| Host baterium | Enterobacter cloacae complex sp. AR_0002 |
Cargo genes
| Drug resistance gene | dfrA14, sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1A, blaOXA-9, ant(3'')-Ia, aac(6')-Ib, blaKPC-3 |
| Virulence gene | - |
| Metal resistance gene | ncrA, ncrB, ncrC, ncrY |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |