Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114577 |
| Name | oriT_pCIT-a850 |
| Organism | Citrobacter sp. CFNIH10 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP026212 (32405..32453 [+], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pCIT-a850
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 5464 | GenBank | WP_004197733 |
| Name | WP_004197733_pCIT-a850 |
UniProt ID | A0A0E3KB00 |
| Length | 129 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 129 a.a. Molecular weight: 14835.90 Da Isoelectric Point: 4.6012
>WP_004197733.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Bacteria]
MGKVQAYPSDEVCEKINAIVEKRRMEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESVVKTQFSVNKILGIECLSPHVKDDPRWQWKSMVLNIQEDVQEAMRNFFPDEDAEGE
MGKVQAYPSDEVCEKINAIVEKRRMEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESVVKTQFSVNKILGIECLSPHVKDDPRWQWKSMVLNIQEDVQEAMRNFFPDEDAEGE
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E3KB00 |
T4CP
| ID | 10837 | GenBank | WP_042946329 |
| Name | traD_C2U53_RS00855_pCIT-a850 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85713.82 Da Isoelectric Point: 5.3307
>WP_042946329.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASWPDDAGSHAGEQPEPVSQPA
PAVMTVTPAPVKSPPTTKRPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAGTAATASSAGTPAAAAGGTE
QVLAQQSAEQGQAMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDLEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASWPDDAGSHAGEQPEPVSQPA
PAVMTVTPAPVKSPPTTKRPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAGTAATASSAGTPAAAAGGTE
QVLAQQSAEQGQAMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDLEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1494..33011
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2U53_RS00855 (C2U53_00855) | 1494..3803 | - | 2310 | WP_042946329 | type IV conjugative transfer system coupling protein TraD | virb4 |
| C2U53_RS29725 | 3929..4621 | - | 693 | WP_009309879 | hypothetical protein | - |
| C2U53_RS00870 (C2U53_00870) | 5356..8031 | - | 2676 | Protein_3 | conjugal transfer mating-pair stabilization protein TraG | - |
| C2U53_RS00885 (C2U53_00885) | 8313..9389 | + | 1077 | WP_000227969 | IS110 family transposase | - |
| C2U53_RS00890 (C2U53_00890) | 9421..9603 | - | 183 | Protein_5 | traG protein | - |
| C2U53_RS00895 (C2U53_00895) | 9603..10973 | - | 1371 | WP_009309877 | conjugal transfer pilus assembly protein TraH | traH |
| C2U53_RS00900 (C2U53_00900) | 10960..11388 | - | 429 | WP_004152689 | hypothetical protein | - |
| C2U53_RS00905 (C2U53_00905) | 11381..11953 | - | 573 | WP_009309876 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| C2U53_RS00910 (C2U53_00910) | 11925..12164 | - | 240 | WP_009309875 | type-F conjugative transfer system pilin chaperone TraQ | - |
| C2U53_RS00915 (C2U53_00915) | 12175..12927 | - | 753 | WP_042946327 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| C2U53_RS00920 (C2U53_00920) | 12948..13274 | - | 327 | WP_004194451 | hypothetical protein | - |
| C2U53_RS00925 (C2U53_00925) | 13287..13535 | - | 249 | WP_004152675 | hypothetical protein | - |
| C2U53_RS00930 (C2U53_00930) | 13513..13767 | - | 255 | WP_004195500 | conjugal transfer protein TrbE | - |
| C2U53_RS00935 (C2U53_00935) | 13799..15754 | - | 1956 | WP_049192820 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| C2U53_RS00940 (C2U53_00940) | 15813..16460 | - | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| C2U53_RS00945 (C2U53_00945) | 16604..17206 | - | 603 | WP_022631520 | hypothetical protein | - |
| C2U53_RS00955 (C2U53_00955) | 17927..18475 | - | 549 | WP_022631518 | hypothetical protein | - |
| C2U53_RS00960 (C2U53_00960) | 18490..19449 | - | 960 | WP_029497356 | conjugal transfer pilus assembly protein TraU | traU |
| C2U53_RS00965 (C2U53_00965) | 19493..20119 | - | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| C2U53_RS00970 (C2U53_00970) | 20119..20511 | - | 393 | WP_042946321 | type-F conjugative transfer system protein TrbI | - |
| C2U53_RS00975 (C2U53_00975) | 20508..23147 | - | 2640 | WP_042946320 | type IV secretion system protein TraC | virb4 |
| C2U53_RS00980 (C2U53_00980) | 23219..23617 | - | 399 | WP_074186017 | hypothetical protein | - |
| C2U53_RS00985 (C2U53_00985) | 23625..23915 | - | 291 | WP_023340940 | hypothetical protein | - |
| C2U53_RS00990 (C2U53_00990) | 23912..24316 | - | 405 | WP_042939116 | hypothetical protein | - |
| C2U53_RS00995 (C2U53_00995) | 24383..24694 | - | 312 | WP_023316403 | hypothetical protein | - |
| C2U53_RS01000 (C2U53_01000) | 24695..24913 | - | 219 | WP_023316402 | hypothetical protein | - |
| C2U53_RS01005 (C2U53_01005) | 24937..25221 | - | 285 | WP_023316401 | hypothetical protein | - |
| C2U53_RS01010 (C2U53_01010) | 25226..25636 | - | 411 | WP_020805613 | hypothetical protein | - |
| C2U53_RS01015 (C2U53_01015) | 25768..26337 | - | 570 | WP_023340942 | type IV conjugative transfer system lipoprotein TraV | traV |
| C2U53_RS01020 (C2U53_01020) | 26360..26956 | - | 597 | WP_023340943 | conjugal transfer pilus-stabilizing protein TraP | - |
| C2U53_RS01025 (C2U53_01025) | 26949..28373 | - | 1425 | WP_042946342 | F-type conjugal transfer pilus assembly protein TraB | traB |
| C2U53_RS01030 (C2U53_01030) | 28373..29113 | - | 741 | WP_032738531 | type-F conjugative transfer system secretin TraK | traK |
| C2U53_RS01035 (C2U53_01035) | 29100..29666 | - | 567 | WP_020316627 | type IV conjugative transfer system protein TraE | traE |
| C2U53_RS01040 (C2U53_01040) | 29686..29991 | - | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| C2U53_RS01045 (C2U53_01045) | 30005..30373 | - | 369 | WP_042946346 | type IV conjugative transfer system pilin TraA | - |
| C2U53_RS01050 (C2U53_01050) | 30423..30641 | - | 219 | WP_172619300 | TraY domain-containing protein | - |
| C2U53_RS01055 (C2U53_01055) | 30791..31465 | - | 675 | WP_004197737 | hypothetical protein | - |
| C2U53_RS01060 (C2U53_01060) | 31704..32093 | - | 390 | WP_004197733 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| C2U53_RS01065 (C2U53_01065) | 32526..33011 | + | 486 | WP_022631514 | transglycosylase SLT domain-containing protein | virB1 |
| C2U53_RS01070 (C2U53_01070) | 33044..33373 | - | 330 | WP_011977736 | DUF5983 family protein | - |
| C2U53_RS01075 (C2U53_01075) | 33406..34227 | - | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| C2U53_RS01085 (C2U53_01085) | 35047..35880 | - | 834 | WP_004152751 | N-6 DNA methylase | - |
| C2U53_RS01090 (C2U53_01090) | 35931..36077 | - | 147 | WP_004152750 | hypothetical protein | - |
| C2U53_RS01095 (C2U53_01095) | 36172..36519 | - | 348 | WP_004152749 | hypothetical protein | - |
| C2U53_RS01100 (C2U53_01100) | 36576..36929 | - | 354 | WP_004152748 | hypothetical protein | - |
| C2U53_RS01115 (C2U53_01115) | 37559..37909 | - | 351 | WP_004153414 | hypothetical protein | - |
Host bacterium
| ID | 15012 | GenBank | NZ_CP026212 |
| Plasmid name | pCIT-a850 | Incompatibility group | IncFII |
| Plasmid size | 126940 bp | Coordinate of oriT [Strand] | 32405..32453 [+] |
| Host baterium | Citrobacter sp. CFNIH10 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | silE, arsR, arsD, arsA, arsB, arsC |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |