Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114476
Name   oriT_psfSMH12b in_silico
Organism   Sinorhizobium fredii strain SMH12
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP035039 (87459..87515 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
 6..11, 20..25  (AAAATG..CATTTT)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCCCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_psfSMH12b
GCAGGAAAATGGCGTAGCACATTTTTCCGTATCCTGCCCCTCTAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10755 GenBank   WP_255876959
Name   t4cp2_EPK84_RS14035_psfSMH12b insolico UniProt ID   _
Length   548 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 548 a.a.        Molecular weight: 59405.51 Da        Isoelectric Point: 6.7883

>WP_255876959.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium fredii]
MRVTKAFLTMTRLAVQNPGWAFANLLAIVLSKSGLKFAAIYMGLVIVAGVTAGPMLMEAGFQEGTWAWGV
FNIAFMIFMALLFLAMIAPFVSLHFGHLDAETHGSARFATDTEVAPLARADSGLLIGRDPKSGKLLRYDG
PAHLLTMAPTRTGKGVGTIIPNLLTADRSVICIDPKGENAKIAGRARQQFGPVHVLDPFDVTGTPSAAFN
PLDALDPDGLDVAEDASTLADALVLDEPGMAGEAHWNEEAKALLAGLILKIVAAESPGRRHLGTLREYLT
LAPERFAALLTRMQDMDEAGGLIARAANRHLGKSDREAAGVLSAAQRHTHFLDSPRMTTVLGRSDFRFAD
LKHRNASVFLVLPPDRLSTYSRWLRLLITQSLFDMARVPAKPEAPVLYLLDEFAALGHLASVERAMGLMA
GYGVQLWPILQDVHQLRATYGQRAGTFLSNAGVFQVFGVNDHDSARLVSDLLGQETVVFQTMARALDSEK
SGISFSQQQTGRPLLTPDEVRSMAQHIELLFLAGQRPIIAGKLAYYADPEFRGLYDAP

  Protein domains


Predicted by InterproScan.

(131-541)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 488940..498012

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EPK84_RS13755 (EPK84_14195) 484204..484350 + 147 WP_015633573 family 16 glycosylhydrolase -
EPK84_RS13760 (EPK84_14200) 484484..485242 + 759 Protein_485 IS256 family transposase -
EPK84_RS13765 (EPK84_14205) 485298..486695 + 1398 WP_014328799 IS1182 family transposase -
EPK84_RS13770 (EPK84_14215) 487184..488478 - 1295 Protein_487 IncP-type conjugal transfer protein TrbI -
EPK84_RS13775 (EPK84_14220) 488490..488936 - 447 WP_014858040 conjugal transfer protein TrbH -
EPK84_RS13780 (EPK84_14225) 488940..489752 - 813 WP_014858039 P-type conjugative transfer protein TrbG virB9
EPK84_RS13785 (EPK84_14230) 489770..490432 - 663 WP_014858038 conjugal transfer protein TrbF virB8
EPK84_RS13790 (EPK84_14235) 490456..491631 - 1176 WP_034859627 P-type conjugative transfer protein TrbL virB6
EPK84_RS13795 (EPK84_14240) 491625..491822 - 198 WP_014858036 entry exclusion protein TrbK -
EPK84_RS13800 (EPK84_14245) 491819..492622 - 804 WP_014858035 P-type conjugative transfer protein TrbJ virB5
EPK84_RS13805 (EPK84_14250) 492594..494825 - 2232 Protein_494 conjugal transfer protein TrbE -
EPK84_RS13810 (EPK84_14255) 494904..495926 + 1023 WP_014328393 IS110 family transposase -
EPK84_RS13815 (EPK84_14260) 496126..496359 - 234 WP_014858033 hypothetical protein virb4
EPK84_RS13820 (EPK84_14265) 496370..496669 - 300 WP_010875429 conjugal transfer protein TrbD virB3
EPK84_RS13825 (EPK84_14270) 496662..497045 - 384 WP_034859524 TrbC/VirB2 family protein virB2
EPK84_RS13830 (EPK84_14275) 497035..498012 - 978 WP_015633597 P-type conjugative transfer ATPase TrbB virB11
EPK84_RS13835 (EPK84_14280) 498023..498649 - 627 WP_014858030 acyl-homoserine-lactone synthase -
EPK84_RS13840 (EPK84_14285) 499440..500663 + 1224 WP_014858029 plasmid partitioning protein RepA -
EPK84_RS13845 (EPK84_14290) 500721..501701 + 981 WP_014858028 plasmid partitioning protein RepB -


Host bacterium


ID   14911 GenBank   NZ_CP035039
Plasmid name   psfSMH12b Incompatibility group   -
Plasmid size   556376 bp Coordinate of oriT [Strand]   87459..87515 [-]
Host baterium   Sinorhizobium fredii strain SMH12

Cargo genes


Drug resistance gene   -
Virulence gene   gmd, htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   nodA, nodB, nodC, nodI, nodJ, nifS, fixU, nifZ, nifB, fixX, fixC, fixB, fixA, nifH, nifD, nifK, nifE, nifX, nodD, nodZ, noeL, nolV, nolU, nolT, nopB, nolW, nolX, mLTONO_5203
Anti-CRISPR   AcrIC6