Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114439 |
| Name | oriT_pT32S2  |
| Organism | Shigella flexneri strain 2aT32 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP106858 (14026..14078 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pT32S2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 10731 | GenBank | WP_304533035 |
| Name | t4cp2_OBG40_RS23810_pT32S2 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73361.02 Da Isoelectric Point: 9.4305
>WP_304533035.1 type IV secretory system conjugative DNA transfer family protein [Shigella flexneri]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHK
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHK
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 29240..52209
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBG40_RS23745 (OBG40_23715) | 24729..25853 | - | 1125 | WP_000486719 | site-specific integrase | - |
| OBG40_RS23750 | 25902..26210 | + | 309 | WP_050481721 | hypothetical protein | - |
| OBG40_RS23755 (OBG40_23720) | 26398..26529 | + | 132 | WP_255639686 | hypothetical protein | - |
| OBG40_RS23760 (OBG40_23725) | 26568..26723 | + | 156 | WP_001358489 | hypothetical protein | - |
| OBG40_RS25075 | 26994..27215 | + | 222 | Protein_39 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| OBG40_RS23765 (OBG40_23730) | 27212..28588 | - | 1377 | WP_053919723 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| OBG40_RS23770 (OBG40_23735) | 28601..29236 | - | 636 | WP_000934978 | A24 family peptidase | - |
| OBG40_RS23775 (OBG40_23740) | 29240..29722 | - | 483 | WP_023226007 | lytic transglycosylase domain-containing protein | virB1 |
| OBG40_RS23780 (OBG40_23745) | 29789..30346 | - | 558 | WP_000095049 | type 4 pilus major pilin | - |
| OBG40_RS23785 (OBG40_23750) | 30391..31500 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| OBG40_RS23790 (OBG40_23755) | 31491..33029 | - | 1539 | WP_000466227 | GspE/PulE family protein | virB11 |
| OBG40_RS23795 (OBG40_23760) | 33054..33548 | - | 495 | WP_060579090 | type IV pilus biogenesis protein PilP | - |
| OBG40_RS23800 (OBG40_23765) | 33532..34842 | - | 1311 | WP_024222069 | type 4b pilus protein PilO2 | - |
| OBG40_RS23805 (OBG40_23770) | 34893..36536 | - | 1644 | WP_060579089 | PilN family type IVB pilus formation outer membrane protein | - |
| OBG40_RS23810 (OBG40_23775) | 36587..38545 | - | 1959 | WP_304533035 | type IV secretory system conjugative DNA transfer family protein | - |
| OBG40_RS23815 (OBG40_23780) | 38561..39616 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| OBG40_RS23820 (OBG40_23785) | 39635..40774 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| OBG40_RS23825 (OBG40_23790) | 40764..41465 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| OBG40_RS23830 (OBG40_23795) | 41531..42265 | - | 735 | WP_023155253 | virB8 family protein | virB8 |
| OBG40_RS23835 (OBG40_23800) | 42431..44788 | - | 2358 | WP_060579122 | VirB4 family type IV secretion system protein | virb4 |
| OBG40_RS23840 (OBG40_23805) | 44794..45114 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| OBG40_RS23845 (OBG40_23810) | 45185..45475 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| OBG40_RS23850 (OBG40_23815) | 45475..46059 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| OBG40_RS23855 (OBG40_23820) | 46080..46478 | - | 399 | WP_023155251 | hypothetical protein | - |
| OBG40_RS23860 (OBG40_23825) | 46597..47034 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| OBG40_RS23865 (OBG40_23830) | 47040..48317 | - | 1278 | WP_060579123 | toxin co-regulated pilus biosynthesis Q family protein | - |
| OBG40_RS23870 (OBG40_23835) | 48320..48619 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| OBG40_RS23875 (OBG40_23840) | 48686..49321 | - | 636 | WP_023155501 | hypothetical protein | - |
| OBG40_RS23880 (OBG40_23845) | 49369..50178 | + | 810 | WP_023155500 | DUF5710 domain-containing protein | - |
| OBG40_RS23885 (OBG40_23850) | 50311..50565 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| OBG40_RS23890 (OBG40_23855) | 50567..51208 | - | 642 | WP_001463086 | type IV secretion system protein | - |
| OBG40_RS23895 (OBG40_23860) | 51214..52209 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| OBG40_RS23900 (OBG40_23865) | 52213..52470 | - | 258 | WP_023155499 | hypothetical protein | - |
| OBG40_RS23905 (OBG40_23870) | 52467..52769 | - | 303 | WP_001360345 | hypothetical protein | - |
| OBG40_RS23910 (OBG40_23875) | 53183..53845 | - | 663 | WP_001243162 | hypothetical protein | - |
| OBG40_RS23915 (OBG40_23880) | 54030..54473 | - | 444 | WP_072121154 | NfeD family protein | - |
| OBG40_RS23920 (OBG40_23885) | 54535..55512 | - | 978 | WP_000564239 | SPFH domain-containing protein | - |
| OBG40_RS23925 (OBG40_23890) | 55534..55728 | - | 195 | WP_001127356 | DUF1187 family protein | - |
| OBG40_RS23930 (OBG40_23895) | 55721..56173 | - | 453 | WP_226454419 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 14874 | GenBank | NZ_CP106858 |
| Plasmid name | pT32S2 | Incompatibility group | IncI2 |
| Plasmid size | 57310 bp | Coordinate of oriT [Strand] | 14026..14078 [-] |
| Host baterium | Shigella flexneri strain 2aT32 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |