Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114434
Name   oriT_AR_0157|unnamed2 in_silico
Organism   Citrobacter sp. CRE-46 strain AR_0157
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP029730 (78837..78941 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      56..61, 74..79  (TGGAAT..ATTCCA)
 46..51, 56..61  (ATTCCA..TGGAAT)
 1..6, 8..13  (AATTTG..CAAATT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_AR_0157|unnamed2
AATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10723 GenBank   WP_006472393
Name   t4cp2_AN232_RS28265_AR_0157|unnamed2 insolico UniProt ID   _
Length   667 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 667 a.a.        Molecular weight: 72973.03 Da        Isoelectric Point: 6.4199

>WP_006472393.1 MULTISPECIES: conjugal transfer protein TraG [Pseudomonadota]
MQGQGVLFGQIAAVLGIVIAGVWGATQWTAAALGYQLRLGSPWFDFFGTPVYHPWRLFEWWFFFDAYAPQ
VFDIGGSIAGGSGLLAVVVAIAMSVWRSRQAKLVTTYGSARWAEADDIRKAGLTQPAGVFLGKYRNEYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTKHLGGAPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIASEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPTDEAVVMVSSVAPIKANKLRYYADANFKSRVLPPPA
LAAGQYADAPPARPDDWSGLAIPAVPTAPATGLSSDDAGTADDGGPRRQPELSEVAEYSPEPQPAGTDLA
LLDDDDDLPLPLPRQFDPAMQRTARLASLDPNDGIDL

  Protein domains


Predicted by InterproScan.

(112-559)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 55535..65148

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AN232_RS28255 (AN232_28255) 51635..52555 + 921 Protein_59 LysR family transcriptional regulator -
AN232_RS32205 (AN232_28260) 52575..52838 + 264 WP_023106770 hypothetical protein -
AN232_RS28265 (AN232_28265) 53074..55077 + 2004 WP_006472393 conjugal transfer protein TraG -
AN232_RS28270 (AN232_28270) 55074..55538 + 465 WP_006472392 ribbon-helix-helix protein, CopG family -
AN232_RS28275 (AN232_28275) 55535..56602 + 1068 WP_006472391 P-type conjugative transfer ATPase TrbB virB11
AN232_RS28280 (AN232_28280) 56599..56982 + 384 WP_110498890 TrbC/VirB2 family protein virB2
AN232_RS28285 (AN232_28285) 56979..57251 + 273 WP_110498891 VirB3 family type IV secretion system protein virB3
AN232_RS28290 (AN232_28290) 57264..59714 + 2451 WP_110498892 conjugal transfer protein TrbE virb4
AN232_RS28295 (AN232_28295) 59711..60448 + 738 WP_006472387 P-type conjugative transfer protein TrbJ virB5
AN232_RS28300 (AN232_28300) 60460..60786 + 327 WP_023106769 hypothetical protein -
AN232_RS28305 (AN232_28305) 60783..62159 + 1377 WP_023106768 P-type conjugative transfer protein TrbL virB6
AN232_RS28310 (AN232_28310) 62172..62876 + 705 WP_006472385 conjugal transfer protein TrbF virB8
AN232_RS28315 (AN232_28315) 62873..63865 + 993 WP_006472384 P-type conjugative transfer protein TrbG virB9
AN232_RS28320 (AN232_28320) 63868..65148 + 1281 WP_006472383 TrbI/VirB10 family protein virB10
AN232_RS28325 (AN232_28325) 65145..65387 + 243 WP_006472382 DUF2274 domain-containing protein -
AN232_RS31880 (AN232_28330) 65609..65857 - 249 WP_204354936 hypothetical protein -
AN232_RS28335 (AN232_28335) 65883..66740 - 858 WP_001167036 hypothetical protein -
AN232_RS28340 (AN232_28340) 66727..66957 - 231 WP_000972665 hypothetical protein -
AN232_RS28345 (AN232_28345) 66957..67475 - 519 WP_000210757 nitrite reductase -
AN232_RS28350 (AN232_28350) 67472..67918 - 447 WP_000919343 hypothetical protein -
AN232_RS28355 (AN232_28355) 67918..68277 - 360 WP_000422769 hypothetical protein -
AN232_RS28360 (AN232_28360) 68335..68763 - 429 WP_000591076 hypothetical protein -
AN232_RS28365 (AN232_28365) 68797..69657 - 861 WP_000139696 DsbA family protein -


Host bacterium


ID   14869 GenBank   NZ_CP029730
Plasmid name   AR_0157|unnamed2 Incompatibility group   IncA/C2
Plasmid size   136246 bp Coordinate of oriT [Strand]   78837..78941 [-]
Host baterium   Citrobacter sp. CRE-46 strain AR_0157

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -