Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114378 |
| Name | oriT_pSa27-TC-CIP  |
| Organism | Salmonella sp. strain Sa27 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MH884653 (193449..193537 [+], 89 nt) |
| oriT length | 89 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 89 nt
>oriT_pSa27-TC-CIP
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 9219 | GenBank | WP_001306778 |
| Name | nikB_HXJ08_RS00980_pSa27-TC-CIP |
UniProt ID | Q79VV7 |
| Length | 899 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 899 a.a. Molecular weight: 104010.41 Da Isoelectric Point: 7.4265
>WP_001306778.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q79VV7 |
Auxiliary protein
| ID | 5405 | GenBank | WP_001283947 |
| Name | WP_001283947_pSa27-TC-CIP |
UniProt ID | A0A142CMC2 |
| Length | 110 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 110 a.a. Molecular weight: 12613.57 Da Isoelectric Point: 10.7463
>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A142CMC2 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 149906..188070
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXJ08_RS00765 (EPNHJBFF_00359) | 144968..146035 | + | 1068 | WP_021513968 | type IV pilus biogenesis lipoprotein PilL | - |
| HXJ08_RS00770 (EPNHJBFF_00360) | 146035..146472 | + | 438 | WP_000539811 | type IV pilus biogenesis protein PilM | - |
| HXJ08_RS00775 (EPNHJBFF_00361) | 146486..148168 | + | 1683 | WP_000748143 | PilN family type IVB pilus formation outer membrane protein | - |
| HXJ08_RS00780 (EPNHJBFF_00362) | 148161..149456 | + | 1296 | WP_000752776 | type 4b pilus protein PilO2 | - |
| HXJ08_RS00785 (EPNHJBFF_00363) | 149443..149895 | + | 453 | WP_001247333 | type IV pilus biogenesis protein PilP | - |
| HXJ08_RS00790 (EPNHJBFF_00364) | 149906..151459 | + | 1554 | WP_000362204 | GspE/PulE family protein | virB11 |
| HXJ08_RS00795 (EPNHJBFF_00365) | 151472..152557 | + | 1086 | WP_001208803 | type II secretion system F family protein | - |
| HXJ08_RS00800 | 152574..153186 | + | 613 | Protein_160 | type 4 pilus major pilin | - |
| HXJ08_RS00805 (EPNHJBFF_00369) | 153196..153756 | + | 561 | WP_000014005 | lytic transglycosylase domain-containing protein | virB1 |
| HXJ08_RS00810 (EPNHJBFF_00370) | 153741..154397 | + | 657 | WP_001193551 | A24 family peptidase | - |
| HXJ08_RS00815 (EPNHJBFF_00371) | 154397..155632 | + | 1236 | WP_255257741 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HXJ08_RS00820 (EPNHJBFF_00374) | 157320..158474 | + | 1155 | WP_001139955 | tyrosine-type recombinase/integrase | - |
| HXJ08_RS00825 (EPNHJBFF_00375) | 158625..159449 | + | 825 | WP_015058912 | conjugal transfer protein TraE | traE |
| HXJ08_RS00830 (EPNHJBFF_00376) | 159535..160737 | + | 1203 | WP_000976357 | conjugal transfer protein TraF | - |
| HXJ08_RS00835 (EPNHJBFF_00377) | 160797..161381 | + | 585 | WP_000977520 | histidine phosphatase family protein | - |
| HXJ08_RS00840 (EPNHJBFF_00378) | 161776..162234 | + | 459 | WP_001079808 | IncI1-type conjugal transfer lipoprotein TraH | - |
| HXJ08_RS00845 (EPNHJBFF_00379) | 162231..163049 | + | 819 | WP_000646097 | IncI1-type conjugal transfer lipoprotein TraI | traI |
| HXJ08_RS00850 (EPNHJBFF_00380) | 163046..164194 | + | 1149 | WP_001024976 | plasmid transfer ATPase TraJ | virB11 |
| HXJ08_RS00855 (EPNHJBFF_00381) | 164191..164481 | + | 291 | WP_001299214 | hypothetical protein | traK |
| HXJ08_RS00860 (EPNHJBFF_00382) | 164496..165047 | + | 552 | WP_000014584 | phospholipase D family protein | - |
| HXJ08_RS00865 (EPNHJBFF_00383) | 165141..168908 | + | 3768 | WP_176704828 | LPD7 domain-containing protein | - |
| HXJ08_RS00870 (EPNHJBFF_00384) | 168926..169273 | + | 348 | WP_001055900 | conjugal transfer protein | traL |
| HXJ08_RS00875 (EPNHJBFF_00385) | 169270..169962 | + | 693 | WP_000138552 | DotI/IcmL family type IV secretion protein | traM |
| HXJ08_RS00880 (EPNHJBFF_00386) | 169973..170956 | + | 984 | WP_176704381 | IncI1-type conjugal transfer protein TraN | traN |
| HXJ08_RS00885 (EPNHJBFF_00387) | 170959..172248 | + | 1290 | WP_001271994 | conjugal transfer protein TraO | traO |
| HXJ08_RS00890 (EPNHJBFF_00388) | 172248..172952 | + | 705 | WP_023155244 | IncI1-type conjugal transfer protein TraP | traP |
| HXJ08_RS00895 (EPNHJBFF_00389) | 172952..173479 | + | 528 | WP_001055569 | conjugal transfer protein TraQ | traQ |
| HXJ08_RS00900 (EPNHJBFF_00390) | 173530..173934 | + | 405 | WP_000086960 | IncI1-type conjugal transfer protein TraR | traR |
| HXJ08_RS00905 (EPNHJBFF_00391) | 173998..174186 | + | 189 | WP_001277255 | putative conjugal transfer protein TraS | - |
| HXJ08_RS00910 (EPNHJBFF_00392) | 174170..174970 | + | 801 | WP_001164792 | IncI1-type conjugal transfer protein TraT | traT |
| HXJ08_RS00915 (EPNHJBFF_00393) | 175060..178104 | + | 3045 | WP_001024776 | IncI1-type conjugal transfer protein TraU | traU |
| HXJ08_RS00920 (EPNHJBFF_00394) | 178104..178718 | + | 615 | WP_000337399 | IncI1-type conjugal transfer protein TraV | traV |
| HXJ08_RS00925 (EPNHJBFF_00395) | 178685..179887 | + | 1203 | WP_001385654 | IncI1-type conjugal transfer protein TraW | traW |
| HXJ08_RS00930 (EPNHJBFF_00396) | 179916..180500 | + | 585 | WP_001037987 | IncI1-type conjugal transfer protein TraX | - |
| HXJ08_RS00935 (EPNHJBFF_00397) | 180597..182765 | + | 2169 | WP_000698354 | DotA/TraY family protein | traY |
| HXJ08_RS00940 (EPNHJBFF_00398) | 182836..183498 | + | 663 | WP_000644796 | plasmid IncI1-type surface exclusion protein ExcA | - |
| HXJ08_RS00945 (EPNHJBFF_00399) | 183570..183779 | - | 210 | WP_039025903 | HEAT repeat domain-containing protein | - |
| HXJ08_RS00950 (EPNHJBFF_00400) | 184171..184347 | + | 177 | WP_001054897 | hypothetical protein | - |
| HXJ08_RS01460 (EPNHJBFF_00401) | 184412..184507 | - | 96 | WP_001303310 | DinQ-like type I toxin DqlB | - |
| HXJ08_RS00955 (EPNHJBFF_00402) | 185006..185257 | + | 252 | WP_001291964 | hypothetical protein | - |
| HXJ08_RS00960 (EPNHJBFF_00403) | 185329..185481 | - | 153 | WP_001331364 | Hok/Gef family protein | - |
| HXJ08_RS00965 (EPNHJBFF_00404) | 185773..186981 | + | 1209 | WP_000121273 | IncI1-type conjugal transfer protein TrbA | trbA |
| HXJ08_RS00970 (EPNHJBFF_00405) | 187000..188070 | + | 1071 | WP_000151582 | IncI1-type conjugal transfer protein TrbB | trbB |
| HXJ08_RS01450 (EPNHJBFF_00406) | 188063..190355 | + | 2293 | Protein_196 | F-type conjugative transfer protein TrbC | - |
Region 2: 259213..268420
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXJ08_RS01360 (EPNHJBFF_00481) | 254322..255038 | - | 717 | WP_000838218 | zinc finger-like domain-containing protein | - |
| HXJ08_RS01365 (EPNHJBFF_00482) | 255035..255235 | - | 201 | WP_000594931 | hypothetical protein | - |
| HXJ08_RS01370 (EPNHJBFF_00483) | 255253..256308 | - | 1056 | WP_001065779 | hypothetical protein | - |
| HXJ08_RS01375 (EPNHJBFF_00484) | 256785..257660 | + | 876 | WP_000594612 | RepB family plasmid replication initiator protein | - |
| HXJ08_RS01380 (EPNHJBFF_00486) | 258809..259162 | + | 354 | WP_000423602 | hypothetical protein | - |
| HXJ08_RS01385 (EPNHJBFF_00487) | 259213..259530 | + | 318 | WP_000043357 | type IV conjugative transfer system protein TraL | traL |
| HXJ08_RS01390 (EPNHJBFF_00488) | 259542..260330 | + | 789 | WP_000783153 | TraE/TraK family type IV conjugative transfer system protein | traE |
| HXJ08_RS01395 (EPNHJBFF_00489) | 260330..261601 | + | 1272 | WP_000592090 | type-F conjugative transfer system secretin TraK | traK |
| HXJ08_RS01400 (EPNHJBFF_00490) | 261603..262064 | + | 462 | WP_000521240 | plasmid transfer protein HtdO | - |
| HXJ08_RS01405 (EPNHJBFF_00491) | 262054..263409 | + | 1356 | WP_000351841 | IncHI-type conjugal transfer protein TrhB | traB |
| HXJ08_RS01410 (EPNHJBFF_00492) | 263417..263899 | + | 483 | WP_000377633 | hypothetical protein | - |
| HXJ08_RS01415 (EPNHJBFF_00493) | 264018..264770 | + | 753 | WP_183079335 | protein-disulfide isomerase HtdT | - |
| HXJ08_RS01420 (EPNHJBFF_00494) | 264780..265730 | + | 951 | WP_001022587 | IncHI-type conjugal transfer lipoprotein TrhV | traV |
| HXJ08_RS01425 (EPNHJBFF_00495) | 265739..268420 | + | 2682 | WP_000387412 | TraC family protein | virb4 |
Host bacterium
| ID | 14813 | GenBank | NZ_MH884653 |
| Plasmid name | pSa27-TC-CIP | Incompatibility group | IncI1 |
| Plasmid size | 270379 bp | Coordinate of oriT [Strand] | 193449..193537 [+] |
| Host baterium | Salmonella sp. strain Sa27 |
Cargo genes
| Drug resistance gene | sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, tet(A), qnrS1, oqxA, oqxB |
| Virulence gene | - |
| Metal resistance gene | terW, terZ, terB, terC, terD, terE, silE, silS, silR, silC, silF, silB, silA |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |