Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114335 |
| Name | oriT_SEWLSH-3|unnamed1  |
| Organism | Salmonella enterica subsp. enterica serovar Schwarzengrund strain SEWLSH-3 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP130089 (13005..13057 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_SEWLSH-3|unnamed1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 10643 | GenBank | WP_000338974 |
| Name | t4cp2_QPE09_RS25475_SEWLSH-3|unnamed1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 30600..54110
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPE09_RS25420 (QPE09_25420) | 26089..27213 | - | 1125 | WP_000486716 | site-specific integrase | - |
| QPE09_RS25710 | 27626..27847 | - | 222 | Protein_34 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| QPE09_RS25425 (QPE09_25425) | 28662..29948 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| QPE09_RS25430 (QPE09_25430) | 29961..30596 | - | 636 | WP_000934978 | A24 family peptidase | - |
| QPE09_RS25435 (QPE09_25435) | 30600..31082 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| QPE09_RS25440 (QPE09_25440) | 31148..31705 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| QPE09_RS25445 (QPE09_25445) | 31750..32859 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| QPE09_RS25450 (QPE09_25450) | 32850..34403 | - | 1554 | WP_000466228 | GspE/PulE family protein | virB11 |
| QPE09_RS25455 (QPE09_25455) | 34428..34922 | - | 495 | WP_000912555 | type IV pilus biogenesis protein PilP | - |
| QPE09_RS25460 (QPE09_25460) | 34906..36216 | - | 1311 | WP_024222069 | type 4b pilus protein PilO2 | - |
| QPE09_RS25465 (QPE09_25465) | 36267..37910 | - | 1644 | WP_001035589 | PilN family type IVB pilus formation outer membrane protein | - |
| QPE09_RS25470 (QPE09_25470) | 37903..38421 | - | 519 | WP_010895890 | sigma 54-interacting transcriptional regulator | virb4 |
| QPE09_RS25475 (QPE09_25475) | 38468..40426 | - | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| QPE09_RS25480 (QPE09_25480) | 40442..41497 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| QPE09_RS25485 (QPE09_25485) | 41564..42703 | - | 1140 | WP_302274859 | TrbI/VirB10 family protein | virB10 |
| QPE09_RS25490 (QPE09_25490) | 42693..43394 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| QPE09_RS25495 (QPE09_25495) | 43460..44194 | - | 735 | WP_000432283 | virB8 family protein | virB8 |
| QPE09_RS25500 (QPE09_25500) | 44194..44328 | - | 135 | WP_000701233 | hypothetical protein | - |
| QPE09_RS25505 (QPE09_25505) | 44360..46717 | - | 2358 | WP_010895892 | VirB4 family type IV secretion system protein | virb4 |
| QPE09_RS25510 (QPE09_25510) | 46723..47043 | - | 321 | WP_010895893 | VirB3 family type IV secretion system protein | virB3 |
| QPE09_RS25515 (QPE09_25515) | 47114..47404 | - | 291 | WP_000865478 | TrbC/VirB2 family protein | virB2 |
| QPE09_RS25520 (QPE09_25520) | 47404..47988 | - | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
| QPE09_RS25525 (QPE09_25525) | 48009..48407 | - | 399 | WP_001153669 | hypothetical protein | - |
| QPE09_RS25530 (QPE09_25530) | 48526..48963 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| QPE09_RS25535 (QPE09_25535) | 48969..50204 | - | 1236 | WP_302274861 | toxin co-regulated pilus biosynthesis Q family protein | - |
| QPE09_RS25540 (QPE09_25540) | 50207..50494 | - | 288 | WP_029785630 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| QPE09_RS25545 (QPE09_25545) | 50666..51301 | - | 636 | WP_000835769 | hypothetical protein | - |
| QPE09_RS25550 (QPE09_25550) | 51349..52158 | + | 810 | WP_001005153 | DUF5710 domain-containing protein | - |
| QPE09_RS25555 (QPE09_25555) | 52211..52465 | - | 255 | WP_000609210 | EexN family lipoprotein | - |
| QPE09_RS25560 (QPE09_25560) | 52468..53109 | - | 642 | WP_001434037 | type IV secretion system protein | - |
| QPE09_RS25565 (QPE09_25565) | 53115..54110 | - | 996 | WP_000276068 | type IV secretion system protein | virB6 |
| QPE09_RS25570 (QPE09_25570) | 54114..54371 | - | 258 | WP_000739144 | hypothetical protein | - |
| QPE09_RS25575 (QPE09_25575) | 54368..54670 | - | 303 | WP_000189499 | hypothetical protein | - |
| QPE09_RS25580 (QPE09_25580) | 54884..55477 | - | 594 | WP_001243169 | hypothetical protein | - |
| QPE09_RS25585 (QPE09_25585) | 55628..56290 | - | 663 | WP_187173600 | hypothetical protein | - |
| QPE09_RS25590 (QPE09_25590) | 56301..56471 | - | 171 | WP_000550721 | hypothetical protein | - |
| QPE09_RS25595 (QPE09_25595) | 56475..56918 | - | 444 | WP_000498521 | NfeD family protein | - |
| QPE09_RS25600 (QPE09_25600) | 56980..57932 | - | 953 | Protein_70 | SPFH domain-containing protein | - |
| QPE09_RS25605 (QPE09_25605) | 57959..58135 | - | 177 | WP_000753050 | hypothetical protein | - |
| QPE09_RS25610 (QPE09_25610) | 58128..58343 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| QPE09_RS25615 (QPE09_25615) | 58336..58788 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 14770 | GenBank | NZ_CP130089 |
| Plasmid name | SEWLSH-3|unnamed1 | Incompatibility group | IncI2 |
| Plasmid size | 59919 bp | Coordinate of oriT [Strand] | 13005..13057 [-] |
| Host baterium | Salmonella enterica subsp. enterica serovar Schwarzengrund strain SEWLSH-3 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |