Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114205
Name   oriT_pCFSA244-2 in_silico
Organism   Salmonella enterica subsp. enterica strain CFSA244
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP033254 (13893..13945 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pCFSA244-2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10565 GenBank   WP_015059539
Name   t4cp2_EB533_RS02230_pCFSA244-2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32494..55324

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EB533_RS02150 (EB533_00990) 27628..28281 - 654 WP_170855322 hypothetical protein -
EB533_RS02155 (EB533_00995) 28293..29417 - 1125 WP_000486716 site-specific integrase -
EB533_RS27200 (EB533_01015) 30331..30549 - 219 Protein_34 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
EB533_RS02180 (EB533_01020) 30568..31842 - 1275 WP_235883108 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
EB533_RS02185 (EB533_01025) 31855..32490 - 636 WP_000934977 A24 family peptidase -
EB533_RS02190 (EB533_01030) 32494..32976 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
EB533_RS02195 (EB533_01035) 33042..33605 - 564 WP_034169414 type 4 pilus major pilin -
EB533_RS02200 (EB533_01040) 33655..34764 - 1110 WP_000974903 type II secretion system F family protein -
EB533_RS02205 (EB533_01045) 34755..36293 - 1539 WP_000466225 GspE/PulE family protein virB11
EB533_RS02210 (EB533_01050) 36318..36812 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
EB533_RS02215 (EB533_01055) 36796..38106 - 1311 WP_254701936 type 4b pilus protein PilO2 -
EB533_RS02220 (EB533_01060) 38157..39800 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
EB533_RS02225 (EB533_01065) 39793..40329 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
EB533_RS02230 (EB533_01070) 40376..42334 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
EB533_RS02235 (EB533_01075) 42350..43405 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
EB533_RS02240 (EB533_01080) 43424..44563 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
EB533_RS02245 (EB533_01085) 44553..45254 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
EB533_RS02250 (EB533_01090) 45320..46054 - 735 WP_000432282 virB8 family protein virB8
EB533_RS02255 (EB533_01095) 46054..46188 - 135 WP_000701233 hypothetical protein -
EB533_RS02260 (EB533_01100) 46220..48577 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
EB533_RS02265 (EB533_01105) 48583..48903 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
EB533_RS26940 48974..49264 - 291 WP_000865479 conjugal transfer protein -
EB533_RS02275 (EB533_01115) 49264..49848 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
EB533_RS02280 (EB533_01120) 49869..50267 - 399 WP_001153669 hypothetical protein -
EB533_RS02285 (EB533_01125) 50386..50823 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
EB533_RS02290 (EB533_01130) 50829..52064 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
EB533_RS02295 (EB533_01135) 52067..52366 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
EB533_RS02300 (EB533_01140) 52414..53223 + 810 WP_024237698 DUF5710 domain-containing protein -
EB533_RS02305 (EB533_01145) 53446..53670 - 225 WP_000713562 EexN family lipoprotein -
EB533_RS02310 (EB533_01150) 53679..54323 - 645 WP_001310442 type IV secretion system protein -
EB533_RS02315 (EB533_01155) 54329..55324 - 996 WP_001028540 type IV secretion system protein virB6
EB533_RS02320 (EB533_01160) 55328..55585 - 258 WP_000739144 hypothetical protein -
EB533_RS02325 (EB533_01165) 55582..55884 - 303 WP_001360345 hypothetical protein -
EB533_RS02330 (EB533_01170) 55865..56122 - 258 WP_001542015 hypothetical protein -
EB533_RS02335 (EB533_01175) 56155..56601 - 447 WP_001243165 hypothetical protein -
EB533_RS26750 56612..56782 - 171 WP_000550720 hypothetical protein -
EB533_RS02340 (EB533_01180) 56786..57229 - 444 WP_000964330 NfeD family protein -
EB533_RS02350 (EB533_01190) 57603..58556 - 954 WP_072089442 SPFH domain-containing protein -
EB533_RS26755 58583..58759 - 177 WP_000753050 hypothetical protein -
EB533_RS02355 (EB533_01195) 58752..58967 - 216 WP_001127357 DUF1187 family protein -
EB533_RS02360 (EB533_01200) 58960..59412 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   14640 GenBank   NZ_CP033254
Plasmid name   pCFSA244-2 Incompatibility group   -
Plasmid size   60381 bp Coordinate of oriT [Strand]   13893..13945 [-]
Host baterium   Salmonella enterica subsp. enterica strain CFSA244

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -