Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114199
Name   oriT_pCFSA664-3 in_silico
Organism   Salmonella enterica subsp. enterica strain CFSA664
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP033355 (8474..8526 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pCFSA664-3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10563 GenBank   WP_015059539
Name   t4cp2_EB780_RS04095_pCFSA664-3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 28724..51554

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EB780_RS27990 (EB780_01905) 24063..24284 + 222 Protein_27 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
EB780_RS27995 (EB780_01915) 24720..24857 + 138 Protein_28 shufflon protein C' -
EB780_RS04035 (EB780_26150) 26208..26567 - 360 WP_254702151 hypothetical protein -
EB780_RS04045 (EB780_01930) 26786..28072 - 1287 WP_104730792 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
EB780_RS04050 (EB780_01935) 28085..28720 - 636 WP_000934977 A24 family peptidase -
EB780_RS04055 (EB780_01940) 28724..29206 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
EB780_RS04060 (EB780_01945) 29272..29835 - 564 WP_034169414 type 4 pilus major pilin -
EB780_RS04065 (EB780_01950) 29885..30994 - 1110 WP_000974903 type II secretion system F family protein -
EB780_RS04070 (EB780_01955) 30985..32523 - 1539 WP_000466225 GspE/PulE family protein virB11
EB780_RS04075 (EB780_01960) 32548..33042 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
EB780_RS04080 (EB780_01965) 33026..34336 - 1311 WP_231255850 type 4b pilus protein PilO2 -
EB780_RS04085 (EB780_01970) 34387..36030 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
EB780_RS04090 (EB780_01975) 36023..36559 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
EB780_RS04095 (EB780_01980) 36606..38564 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
EB780_RS04100 (EB780_01985) 38580..39635 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
EB780_RS04105 (EB780_01990) 39654..40793 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
EB780_RS04110 (EB780_01995) 40783..41484 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
EB780_RS04115 (EB780_02000) 41550..42284 - 735 WP_000432282 virB8 family protein virB8
EB780_RS04120 (EB780_02005) 42284..42418 - 135 WP_000701233 hypothetical protein -
EB780_RS04125 (EB780_02010) 42450..44807 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
EB780_RS04130 (EB780_02015) 44813..45133 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
EB780_RS27660 45204..45494 - 291 WP_000865479 conjugal transfer protein -
EB780_RS04140 (EB780_02025) 45494..46078 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
EB780_RS04145 (EB780_02030) 46099..46497 - 399 WP_001153669 hypothetical protein -
EB780_RS04150 (EB780_02035) 46616..47053 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
EB780_RS04155 (EB780_02040) 47059..48294 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
EB780_RS04160 (EB780_02045) 48297..48596 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
EB780_RS04165 (EB780_02050) 48644..49453 + 810 WP_024237698 DUF5710 domain-containing protein -
EB780_RS04170 (EB780_02055) 49676..49900 - 225 WP_000713562 EexN family lipoprotein -
EB780_RS04175 (EB780_02060) 49909..50553 - 645 WP_001310442 type IV secretion system protein -
EB780_RS04180 (EB780_02065) 50559..51554 - 996 WP_001028540 type IV secretion system protein virB6
EB780_RS04185 (EB780_02070) 51558..51815 - 258 WP_000739144 hypothetical protein -
EB780_RS04190 (EB780_02075) 51812..52114 - 303 WP_001360345 hypothetical protein -
EB780_RS04195 (EB780_02080) 52095..52352 - 258 WP_001542015 hypothetical protein -
EB780_RS04200 (EB780_02085) 52385..52831 - 447 WP_001243165 hypothetical protein -
EB780_RS27440 52842..53012 - 171 WP_000550720 hypothetical protein -
EB780_RS04205 (EB780_02090) 53016..53459 - 444 WP_000964330 NfeD family protein -
EB780_RS04215 (EB780_02100) 53833..54786 - 954 WP_072089442 SPFH domain-containing protein -
EB780_RS27445 54813..54989 - 177 WP_000753050 hypothetical protein -
EB780_RS04220 (EB780_02105) 54982..55197 - 216 WP_001127357 DUF1187 family protein -
EB780_RS04225 (EB780_02110) 55190..55642 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   14634 GenBank   NZ_CP033355
Plasmid name   pCFSA664-3 Incompatibility group   IncI2
Plasmid size   61841 bp Coordinate of oriT [Strand]   8474..8526 [-]
Host baterium   Salmonella enterica subsp. enterica strain CFSA664

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -