Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114099
Name   oriT_pR18.1297_62k in_silico
Organism   Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP100687 (12803..12855 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pR18.1297_62k
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10478 GenBank   WP_254521165
Name   t4cp2_FC640_RS23950_pR18.1297_62k insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73584.31 Da        Isoelectric Point: 9.5070

>WP_254521165.1 type IV secretory system conjugative DNA transfer family protein [Salmonella enterica]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKTKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKTELMNKIARDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35263..57569

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FC640_RS23890 (FC640_23890) 30588..31241 - 654 WP_170965938 hypothetical protein -
FC640_RS23895 (FC640_23895) 31253..32377 - 1125 WP_000486716 site-specific integrase -
FC640_RS24205 32790..33011 - 222 Protein_35 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
FC640_RS23900 (FC640_23900) 33056..33316 + 261 WP_029237379 hypothetical protein -
FC640_RS23905 (FC640_23905) 33295..34611 - 1317 WP_074526577 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
FC640_RS23910 (FC640_23910) 34624..35259 - 636 WP_000934978 A24 family peptidase -
FC640_RS23915 (FC640_23915) 35263..35745 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
FC640_RS23920 (FC640_23920) 35812..36375 - 564 WP_097479680 type 4 pilus major pilin -
FC640_RS23925 (FC640_23925) 36425..37534 - 1110 WP_153674374 type II secretion system F family protein -
FC640_RS23930 (FC640_23930) 37525..39063 - 1539 WP_000466225 GspE/PulE family protein virB11
FC640_RS23935 (FC640_23935) 39088..39582 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
FC640_RS23940 (FC640_23940) 39566..40876 - 1311 WP_001454111 type 4b pilus protein PilO2 -
FC640_RS23945 (FC640_23945) 40927..42570 - 1644 WP_054173908 PilN family type IVB pilus formation outer membrane protein -
FC640_RS23950 (FC640_23950) 42621..44579 - 1959 WP_254521165 type IV secretory system conjugative DNA transfer family protein -
FC640_RS23955 (FC640_23955) 44595..45650 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
FC640_RS23960 (FC640_23960) 45669..46808 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
FC640_RS23965 (FC640_23965) 46798..47499 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
FC640_RS23970 (FC640_23970) 47565..48299 - 735 WP_000432282 virB8 family protein virB8
FC640_RS23975 (FC640_23975) 48299..48433 - 135 WP_000701233 hypothetical protein -
FC640_RS23980 (FC640_23980) 48465..50822 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
FC640_RS23985 (FC640_23985) 50828..51148 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
FC640_RS23990 (FC640_23990) 51219..51509 - 291 WP_000865479 conjugal transfer protein -
FC640_RS23995 (FC640_23995) 51509..52093 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
FC640_RS24000 (FC640_24000) 52114..52512 - 399 WP_001153669 hypothetical protein -
FC640_RS24005 (FC640_24005) 52631..53068 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
FC640_RS24010 (FC640_24010) 53074..54309 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
FC640_RS24015 (FC640_24015) 54312..54611 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
FC640_RS24020 (FC640_24020) 54659..55468 + 810 WP_024237698 DUF5710 domain-containing protein -
FC640_RS24025 (FC640_24025) 55691..55915 - 225 WP_000713562 EexN family lipoprotein -
FC640_RS24030 (FC640_24030) 55924..56568 - 645 WP_001310442 type IV secretion system protein -
FC640_RS24035 (FC640_24035) 56574..57569 - 996 WP_065304446 type IV secretion system protein virB6
FC640_RS24040 (FC640_24040) 57573..57830 - 258 WP_000739144 hypothetical protein -
FC640_RS24045 (FC640_24045) 57827..58129 - 303 WP_065304447 hypothetical protein -
FC640_RS24050 (FC640_24050) 58145..58360 - 216 WP_001360344 hypothetical protein -
FC640_RS24055 (FC640_24055) 58344..58652 - 309 WP_236492988 hypothetical protein -
FC640_RS24060 (FC640_24060) 58699..58869 - 171 WP_044069355 hypothetical protein -
FC640_RS24065 (FC640_24065) 58873..59316 - 444 WP_000498521 NfeD family protein -
FC640_RS24070 (FC640_24070) 59378..60331 - 954 WP_072089442 SPFH domain-containing protein -
FC640_RS24075 (FC640_24075) 60377..60571 - 195 WP_001127356 DUF1187 family protein -
FC640_RS24080 (FC640_24080) 60564..61016 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   14534 GenBank   NZ_CP100687
Plasmid name   pR18.1297_62k Incompatibility group   IncI2
Plasmid size   62147 bp Coordinate of oriT [Strand]   12803..12855 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -