Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   114080
Name   oriT_pR18.0872_16k in_silico
Organism   Salmonella enterica subsp. enterica serovar Thompson strain R18.0872
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP100706 (13197..13347 [+], 151 nt)
oriT length   151 nt
IRs (inverted repeats)      93..98, 106..111  (TGGCCT..AGGCCA)
 12..17, 24..29  (AACCCT..AGGGTT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 151 nt

>oriT_pR18.0872_16k
TGGTCGATGTGAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACATCCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTGCTACATCACAGACGGGATTAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10471 GenBank   WP_000178857
Name   traD_NL734_RS24925_pR18.0872_16k insolico UniProt ID   _
Length   621 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 621 a.a.        Molecular weight: 69225.71 Da        Isoelectric Point: 6.9403

>WP_000178857.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Gammaproteobacteria]
MTMSYDPLAYEMPWRPNYEKNAVAGWLAASGAALAVEQVSTMPPEPFYWMTGICGVMAMARLPKAIKLHL
LQKHLKGRDLEFISIAELQKYIKDTPDDMWLGSGFLWENRHAQRVFEILKRDWTSIVGRESTVKKVVRKI
QGKKKELPIGQPWIHGVEPKEEKLMQPLKHTEGHSLIVGTTGSGKTRMFDILISQAILRGEAVIIIDPKG
DKEMRDNARRACEAMGQPERFVSFHPAFPEESVRIDPLRNFTRVTEIASRLAALIPSEAGADPFKSFGWQ
ALNNIAQGLVITHDRPNLTKLRRFLEGGAAGLVIKAVQAYSERVMPDWEAEAAAYLEKVKNGSREKIAFA
LMKFYYDIIQPEHPNSDLEGLLSMFQHDQTHFSKMVANLLPIMNMLTSGELGPLLSPDSSDLSDERQITD
SAKIINNAQVAYLGLDSLTDNMVGSAMGSIFLSDLTAVAGDRYNYGVNNRPVNIFVDEAAEVINDPFIQL
LNKGRGAKLRLFVATQTFADFAARLGSKDKALQVLGNINNTFALRIVDGETQEYIADNLPKTRLKYVMRT
QGQNSDGKEPIMHGGNQGERLMEEEADLFPAQLLGMLPNLEYIAKISGGTIVKGRLPILTQ

  Protein domains


Predicted by InterproScan.

(170-299)

(471-598)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 818..14327

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL734_RS24860 (NL734_24860) 308..673 + 366 WP_001052530 hypothetical protein -
NL734_RS24865 (NL734_24865) 818..1099 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
NL734_RS24870 (NL734_24870) 1096..1722 + 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
NL734_RS24875 (NL734_24875) 1706..2623 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
NL734_RS24880 (NL734_24880) 2623..3936 + 1314 WP_024131605 TraB/VirB10 family protein traB
NL734_RS24885 (NL734_24885) 3933..4511 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
NL734_RS24890 (NL734_24890) 4515..4907 + 393 WP_000479535 TraA family conjugative transfer protein -
NL734_RS24895 (NL734_24895) 5192..6454 + 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
NL734_RS24900 (NL734_24900) 6778..7923 + 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
NL734_RS24905 (NL734_24905) 8017..8550 + 534 WP_001221666 lipocalin family protein -
NL734_RS24910 (NL734_24910) 8547..8864 - 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
NL734_RS24915 (NL734_24915) 9121..9312 + 192 Protein_11 hypothetical protein -
NL734_RS24920 (NL734_24920) 9473..11284 + 1812 WP_254521175 hypothetical protein -
NL734_RS24925 (NL734_24925) 11281..13146 + 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
NL734_RS24930 (NL734_24930) 13196..13741 + 546 WP_000228720 hypothetical protein -
NL734_RS24935 (NL734_24935) 13698..14327 + 630 WP_000743449 DUF4400 domain-containing protein tfc7
NL734_RS24940 (NL734_24940) 14337..14783 + 447 WP_000122507 hypothetical protein -
NL734_RS24945 (NL734_24945) 14793..15170 + 378 WP_000869297 hypothetical protein -
NL734_RS24950 (NL734_24950) 15170..15832 + 663 WP_001231464 hypothetical protein -


Host bacterium


ID   14515 GenBank   NZ_CP100706
Plasmid name   pR18.0872_16k Incompatibility group   -
Plasmid size   15860 bp Coordinate of oriT [Strand]   13197..13347 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Thompson strain R18.0872

Cargo genes


Drug resistance gene   blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -