Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 114067 |
| Name | oriT_pLH71-A  |
| Organism | Klebsiella michiganensis strain LH71 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP100498 (93951..94000 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pLH71-A
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 9036 | GenBank | WP_254540131 |
| Name | Mob_Pre_NLZ14_RS28170_pLH71-A |
UniProt ID | _ |
| Length | 79 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 79 a.a. Molecular weight: 9000.23 Da Isoelectric Point: 10.2271
>WP_254540131.1 plasmid recombination protein [Klebsiella michiganensis]
MVHRDEATPHFFAFVVLLTDDGRLSAKEFIGNRSKMRDGQSSYAKSGKKLRLERGIEGSRTTHHTVQHYY
KSLSCGMLN
MVHRDEATPHFFAFVVLLTDDGRLSAKEFIGNRSKMRDGQSSYAKSGKKLRLERGIEGSRTTHHTVQHYY
KSLSCGMLN
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 14502 | GenBank | NZ_CP100498 |
| Plasmid name | pLH71-A | Incompatibility group | IncFIB |
| Plasmid size | 125674 bp | Coordinate of oriT [Strand] | 93951..94000 [+] |
| Host baterium | Klebsiella michiganensis strain LH71 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | arsC, arsB, arsA, arsD, arsR, terW, terZ, terA, terB, terC, terD, terE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |