Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 114030
• Name: oriT_pUC11A
• Organism: Lactococcus lactis subsp. lactis strain UC11
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP016720 (22083..22117 [-], 35 nt)
• oriT length: 35 nt
• IRs (inverted repeats): _
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 35 nt

>oriT_pUC11A
ACCACCAATTTTGGAGCGGGTTGTAGGTGCGCATT

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_LLUC11_RS11875_pUC11A

• ID: 9015
• GenBank: WP_237025798
• Name: Relaxase_LLUC11_RS11875_pUC11A
• UniProt ID: _
• Length: 143 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 143 a.a.
• Molecular weight: 16445.53 Da
• Isoelectric Point: 6.2888

>WP_237025798.1 relaxase/mobilization nuclease domain-containing protein [Lactococcus lactis]
MNPEKTNDFEYVSGQNILDIHSTCDEMLATRTMAIALKNKSRKNEIYGYHFVQSFSPDDHLTPEQVHEIG
LKTMKEYLGSSAEFIIATHTDKPHLHNHIVLNATDPLTLNKFQQSKNDLERLKEISDKISKEYGCKIIDR
PND

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (11-140)

Protein structure

No available structure.

Host bacterium

• ID: 14465
• GenBank: NZ_CP016720
• Plasmid name: pUC11A
• Incompatibility group: -
• Plasmid size: 58826 bp
• Coordinate of oriT [Strand]: 22083..22117 [-]
• Host baterium: Lactococcus lactis subsp. lactis strain UC11

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: AcrIIA15