Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   114008
Name   oriT_p509-1022 in_silico
Organism   Shigella sonnei strain 509.1022
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP049182 (86557..86645 [+], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p509-1022
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   9000 GenBank   WP_011264053
Name   nikB_G6O65_RS24685_p509-1022 insolico UniProt ID   A0A767TAZ8
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103882.34 Da        Isoelectric Point: 7.4198

>WP_011264053.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A767TAZ8


Auxiliary protein

ID   5247 GenBank   WP_063119516
Name   WP_063119516_p509-1022 insolico UniProt ID   _
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12585.55 Da        Isoelectric Point: 10.6897

>WP_063119516.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVKKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP

ID   10435 GenBank   WP_011264051
Name   trbC_G6O65_RS24680_p509-1022 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86954.10 Da        Isoelectric Point: 6.7713

>WP_011264051.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKNNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 41500..81179

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6O65_RS24455 (G6O65_24395) 37489..37629 + 141 Protein_54 TcpQ domain-containing protein -
G6O65_RS24460 (G6O65_24400) 37629..38066 + 438 WP_001545758 type IV pilus biogenesis protein PilM -
G6O65_RS24465 (G6O65_24405) 38080..39762 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
G6O65_RS24470 (G6O65_24410) 39755..41050 + 1296 WP_016245572 type 4b pilus protein PilO2 -
G6O65_RS24475 (G6O65_24415) 41037..41489 + 453 WP_001247333 type IV pilus biogenesis protein PilP -
G6O65_RS24480 (G6O65_24420) 41500..43053 + 1554 WP_001545756 GspE/PulE family protein virB11
G6O65_RS24485 (G6O65_24425) 43066..44151 + 1086 WP_001208802 type II secretion system F family protein -
G6O65_RS24490 (G6O65_24430) 44168..44782 + 615 WP_000908227 type 4 pilus major pilin -
G6O65_RS24495 (G6O65_24435) 44792..45352 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
G6O65_RS24500 (G6O65_24440) 45337..45993 + 657 WP_001193549 A24 family peptidase -
G6O65_RS24505 (G6O65_24445) 45981..47414 + 1434 WP_254387833 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
G6O65_RS24945 47411..47635 - 225 Protein_65 hypothetical protein -
G6O65_RS24510 48696..49049 - 354 WP_001393368 hypothetical protein -
G6O65_RS24515 (G6O65_24460) 49048..50202 + 1155 WP_001139958 tyrosine-type recombinase/integrase -
G6O65_RS24520 (G6O65_24465) 50353..51177 + 825 WP_001545755 conjugal transfer protein TraE traE
G6O65_RS24525 (G6O65_24470) 51263..52465 + 1203 WP_000976353 conjugal transfer protein TraF -
G6O65_RS24530 (G6O65_24475) 52525..53109 + 585 WP_000977522 histidine phosphatase family protein -
G6O65_RS24535 (G6O65_24480) 53504..53962 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
G6O65_RS24540 (G6O65_24485) 53959..54777 + 819 WP_097763371 IncI1-type conjugal transfer lipoprotein TraI traI
G6O65_RS24545 (G6O65_24490) 54774..55922 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
G6O65_RS24550 (G6O65_24495) 55919..56209 + 291 WP_001314267 hypothetical protein traK
G6O65_RS24555 (G6O65_24500) 56224..56775 + 552 WP_000014586 phospholipase D family protein -
G6O65_RS24560 (G6O65_24505) 56865..60629 + 3765 WP_001141540 LPD7 domain-containing protein -
G6O65_RS24565 (G6O65_24510) 60647..60994 + 348 WP_001055900 conjugal transfer protein traL
G6O65_RS24570 (G6O65_24515) 60991..61683 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
G6O65_RS24575 (G6O65_24520) 61694..62677 + 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
G6O65_RS24580 (G6O65_24525) 62680..63969 + 1290 WP_001271994 conjugal transfer protein TraO traO
G6O65_RS24585 (G6O65_24530) 63969..64673 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
G6O65_RS24590 (G6O65_24535) 64673..65200 + 528 WP_001055569 conjugal transfer protein TraQ traQ
G6O65_RS24595 (G6O65_24540) 65251..65655 + 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
G6O65_RS24600 (G6O65_24545) 65719..65907 + 189 WP_001277253 putative conjugal transfer protein TraS -
G6O65_RS24605 (G6O65_24550) 65891..66691 + 801 WP_107372244 IncI1-type conjugal transfer protein TraT traT
G6O65_RS24610 (G6O65_24555) 66781..69825 + 3045 WP_107372243 IncI1-type conjugal transfer protein TraU traU
G6O65_RS24615 (G6O65_24560) 69825..70439 + 615 WP_000337395 IncI1-type conjugal transfer protein TraV traV
G6O65_RS24620 (G6O65_24565) 70406..71608 + 1203 WP_107372242 IncI1-type conjugal transfer protein TraW traW
G6O65_RS24625 (G6O65_24570) 71637..72221 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
G6O65_RS24630 (G6O65_24575) 72318..74486 + 2169 WP_001774191 DotA/TraY family protein traY
G6O65_RS24635 (G6O65_24580) 74560..75210 + 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
G6O65_RS24640 (G6O65_24585) 75282..75491 - 210 WP_000062603 HEAT repeat domain-containing protein -
G6O65_RS24645 75857..76033 + 177 WP_001054898 hypothetical protein -
G6O65_RS24790 76098..76193 - 96 WP_000609148 DinQ-like type I toxin DqlB -
G6O65_RS24655 (G6O65_24595) 76694..76945 + 252 WP_001291964 hypothetical protein -
G6O65_RS24660 (G6O65_24600) 77017..77169 - 153 WP_001387489 Hok/Gef family protein -
G6O65_RS24665 (G6O65_24605) 77796..78575 + 780 WP_275450201 protein FinQ -
G6O65_RS24670 (G6O65_24610) 78882..80090 + 1209 WP_107372241 IncI1-type conjugal transfer protein TrbA trbA
G6O65_RS24675 (G6O65_24615) 80109..81179 + 1071 WP_000151590 IncI1-type conjugal transfer protein TrbB trbB
G6O65_RS24680 (G6O65_24620) 81172..83463 + 2292 WP_011264051 F-type conjugative transfer protein TrbC -

Host bacterium

ID   14443 GenBank   NZ_CP049182
Plasmid name   p509-1022 Incompatibility group   IncI1
Plasmid size   87619 bp Coordinate of oriT [Strand]   86557..86645 [+]
Host baterium   Shigella sonnei strain 509.1022

Cargo genes

Drug resistance gene   blaCTX-M-3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2