Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 114001
• Name: oriT_p707804-1FII
• Organism: Leclercia adecarboxylata strain 150707804
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_MH909330 (61858..61941 [-], 84 nt)
• oriT length: 84 nt
• IRs (inverted repeats): _
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 84 nt

>oriT_p707804-1FII
GGGTGTCGGGGCGGAGCCCTGACCAGGTGGCATTTGTAATATCGTGCGTGCGCGGTATTACAAATGCACATCCTGTCCCGTTTT

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_HTU36_RS00400_p707804-1FII

• ID: 8995
• GenBank: WP_172693665
• Name: Relaxase_HTU36_RS00400_p707804-1FII
• UniProt ID: _
• Length: 898 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 898 a.a.
• Molecular weight: 102320.18 Da
• Isoelectric Point: 8.0731

>WP_172693665.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MIPVIPKKRKDGKSSFGDLVSYVSVRDEPQDDDLMEAVRASGTKADMPHSSRFSRLVDYATKLRDESFIS
LVDVMPDGGEWVNFYGVTCFHNCTSIESAAEEMEFAARKAKFAHNKSDPVFHYILSWQSHESPRPEQIYD
SVRHSLSRLGLSDHQFVSAVHTDTDNLHVHVAVNRVHPETGYLNRLPYSQEKLSKACRELELKHGFSPDN
GCYVIAPDNRIVRRTSVERDRQSAWQHGRKPSLKEYIADTAVAGLREAPVTDWPSLHQRFAQAGLFIASD
NGELKVKDGWDRERPGVTLSAFGHSWNTEKLIRKLGEFTPPAQDIFTQVPDVGRYDPDTVTMPSRPERMS
EKETLNEYAVSRLRAPLIALDQNPAQRTMQAVHALLAHSGLYLKEQHDRLVICDGYDQTRTPVRAERVWP
ALTKVVMNSYEGGWQPVPHDIFRQVPPAERFAGGGLEARPVSDREWAKLRTGSGPQGALKREIFSDKESL
WGYAVSHCRQDLEALISSGEFTWERGHELLARQGLLLMREQQGLVVMDAYNHDQTPVKASHVHPDLTLAR
AEPHAGAFVRVPSDIFERVAPVSRYNPELAVSDRDIPGMKRDPELRRQRREARAAARDDLKARYSAWRAN
WQRPDLRNRERWQAIHDECRLRKARIRAQQRDPLVRKLHYHIAELQRMQALIALKESVKAERLELIGQGK
WYPPSYRQWVEVEALKGDKAAISQLRGWDYRDRRSNAVKATTDNRCVVICEPGGTPVYSGVPGLRASLKK
NGRVQFSDSETGRHICTDYGDRVIFRNSDDYDMLKSDMMKVAPVLFSRSPTVGMAPQGDNEQFNAAFAKM
VAWHNVNHREEGEYHISRPDVDQLRVENELRFADMASQSGQEYSQNEPQASWKPPSPL

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (51-317)

Protein structure

No available structure.

T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 68835..101310

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HTU36_RS00405	65208..65981	+	774	WP_172693666	hypothetical protein	-
HTU36_RS00410	66097..66330	-	234	WP_254258577	hypothetical protein	-
HTU36_RS00415	66534..68831	-	2298	WP_172693667	F-type conjugative transfer protein TrbC	-
HTU36_RS00420	68835..70073	-	1239	WP_172693668	hypothetical protein	trbB
HTU36_RS00425	70125..71336	-	1212	WP_172693669	conjugal transfer protein TrbA	trbA
HTU36_RS00430	71662..72294	-	633	WP_172693670	plasmid IncI1-type surface exclusion protein ExcA	-
HTU36_RS00435	72354..74513	-	2160	WP_172693671	DotA/TraY family protein	traY
HTU36_RS00440	74765..75133	-	369	WP_172693672	hypothetical protein	-
HTU36_RS00445	75130..76329	-	1200	WP_272708301	conjugal transfer protein TraW	traW
HTU36_RS00450	76345..76845	-	501	WP_172693674	conjugal transfer protein TraV	traV
HTU36_RS00455	76914..79967	-	3054	WP_172693675	ATP-binding protein	traU
HTU36_RS00460	80038..80895	-	858	WP_223610701	conjugal transfer protein TraT	traT
HTU36_RS00465	80939..81343	-	405	WP_172693676	DUF6750 family protein	traR
HTU36_RS00470	81376..81900	-	525	WP_172693677	conjugal transfer protein TraQ	traQ
HTU36_RS00475	81900..82685	-	786	WP_172693678	conjugal transfer protein TraP	traP
HTU36_RS00480	82688..83989	-	1302	WP_172693679	conjugal transfer protein TraO	traO
HTU36_RS00485	83989..84978	-	990	WP_172693680	DotH/IcmK family type IV secretion protein	traN
HTU36_RS00490	84987..85688	-	702	WP_172693681	DotI/IcmL/TraM family protein	traM
HTU36_RS00495	85694..86032	-	339	WP_172693708	conjugal transfer protein	traL
HTU36_RS00500	86062..89673	-	3612	WP_172693682	LPD7 domain-containing protein	-
HTU36_RS00505	89754..90041	-	288	WP_039031267	IcmT/TraK family protein	traK
HTU36_RS00510	90038..91198	-	1161	WP_172693683	plasmid transfer ATPase TraJ	virB11
HTU36_RS00515	91213..92019	-	807	WP_172693684	type IV secretory system conjugative DNA transfer family protein	traI
HTU36_RS00520	92016..92474	-	459	WP_172693685	DotD/TraH family lipoprotein	-
HTU36_RS00525	92639..93844	-	1206	WP_254258581	conjugal transfer protein TraF	-
HTU36_RS00530	93946..94782	-	837	WP_172693686	hypothetical protein	traE
HTU36_RS00535	94913..95398	-	486	WP_172693687	hypothetical protein	-
HTU36_RS00540	95505..96827	-	1323	WP_217258938	shufflon system plasmid conjugative transfer pilus tip adhesin PilV	-
HTU36_RS00545	96809..97483	-	675	WP_172693689	prepilin peptidase	-
HTU36_RS00550	97468..98025	-	558	WP_172693690	lytic transglycosylase domain-containing protein	virB1
HTU36_RS00555	98035..98649	-	615	WP_172693691	type 4 pilus major pilin	-
HTU36_RS00560	98664..99758	-	1095	WP_172693710	type II secretion system F family protein	-
HTU36_RS00565	99751..101310	-	1560	WP_172693692	GspE/PulE family protein	virB11
HTU36_RS00570	101313..101756	-	444	WP_172693693	type IV pilus biogenesis protein PilP	-
HTU36_RS00575	101788..103071	-	1284	WP_172693694	type 4b pilus protein PilO2	-
HTU36_RS00580	103073..104749	-	1677	WP_172693695	PilN family type IVB pilus formation outer membrane protein	-
HTU36_RS00585	104762..105199	-	438	WP_172693696	type IV pilus biogenesis protein PilM	-

Host bacterium

• ID: 14436
• GenBank: NZ_MH909330
• Plasmid name: p707804-1FII
• Incompatibility group: -
• Plasmid size: 110209 bp
• Coordinate of oriT [Strand]: 61858..61941 [-]
• Host baterium: Leclercia adecarboxylata strain 150707804

Cargo genes

• Drug resistance gene: aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, blaTEM-1B, blaCTX-M-3, sul1
• Virulence gene: -
• Metal resistance gene: merE, merD, merA, merC, merP, merT, merR
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -