Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113876
Name   oriT_pRSM9152_2 in_silico
Organism   Klebsiella michiganensis strain 9152
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP129897 (7943..7991 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pRSM9152_2
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10344 GenBank   WP_301718422
Name   traD_Q0L46_RS30225_pRSM9152_2 insolico UniProt ID   _
Length   767 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 767 a.a.        Molecular weight: 85761.65 Da        Isoelectric Point: 4.9170

>WP_301718422.1 type IV conjugative transfer system coupling protein TraD [Klebsiella michiganensis]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRTLDTRVDTRLSALLEAREAEGSLARALFTPDAPEPEQRDADSKTPVGQPAPESAP
VSPVPVKAGSTAETLAAPASVKAQEAPQAKVTTVPLTRPAPVATSAAATGATVSSVATTTATTGGTEQAL
TQQSAEQGQEMMPAGMTEDGEIEDMAAYDAWLSDEQTQRDMQRREEVNINHSHQRDEPDDIEFGGNF

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 70617..84482

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Q0L46_RS30225 (Q0L46_30225) 70617..72920 - 2304 WP_301718422 type IV conjugative transfer system coupling protein TraD virb4
Q0L46_RS30230 (Q0L46_30230) 73158..73694 - 537 WP_301718420 hypothetical protein -
Q0L46_RS30235 (Q0L46_30235) 73705..76548 - 2844 WP_301718419 conjugal transfer mating-pair stabilization protein TraG traG
Q0L46_RS30240 (Q0L46_30240) 76548..77918 - 1371 WP_301718418 conjugal transfer pilus assembly protein TraH traH
Q0L46_RS30245 (Q0L46_30245) 77905..78480 - 576 WP_301718417 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
Q0L46_RS30250 (Q0L46_30250) 78452..78691 - 240 WP_301718416 type-F conjugative transfer system pilin chaperone TraQ -
Q0L46_RS30255 (Q0L46_30255) 78702..79454 - 753 WP_301718415 type-F conjugative transfer system pilin assembly protein TraF traF
Q0L46_RS30260 (Q0L46_30260) 79473..79799 - 327 WP_301718414 hypothetical protein -
Q0L46_RS30265 (Q0L46_30265) 79810..80037 - 228 WP_064174417 conjugal transfer protein TrbE -
Q0L46_RS30270 (Q0L46_30270) 80027..80308 - 282 WP_064174416 hypothetical protein -
Q0L46_RS30275 (Q0L46_30275) 80346..82226 - 1881 WP_301718413 type-F conjugative transfer system mating-pair stabilization protein TraN traN
Q0L46_RS30280 (Q0L46_30280) 82223..82840 - 618 WP_064381378 type-F conjugative transfer system pilin assembly protein TrbC trbC
Q0L46_RS30285 (Q0L46_30285) 82853..83836 - 984 WP_177342975 conjugal transfer pilus assembly protein TraU traU
Q0L46_RS30290 (Q0L46_30290) 83856..84482 - 627 WP_301743359 type-F conjugative transfer system protein TraW traW
Q0L46_RS30295 (Q0L46_30295) 84479..84886 - 408 WP_301743362 type-F conjugative transfer system protein TrbI -
Q0L46_RS30300 (Q0L46_30300) 84919..86283 - 1365 Protein_103 DUF87 domain-containing protein -


Host bacterium


ID   14311 GenBank   NZ_CP129897
Plasmid name   pRSM9152_2 Incompatibility group   IncFII
Plasmid size   86283 bp Coordinate of oriT [Strand]   7943..7991 [+]
Host baterium   Klebsiella michiganensis strain 9152

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -