Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113875
Name   oriT_pRSM9152_1 in_silico
Organism   Klebsiella michiganensis strain 9152
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP129896 (145135..145181 [-], 47 nt)
oriT length   47 nt
IRs (inverted repeats)      4..11, 14..21  (GCAAAATT..AATTTTGC)
Location of nic site      30..31
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 47 nt

>oriT_pRSM9152_1
TCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10343 GenBank   WP_301717990
Name   traD_Q0L46_RS29010_pRSM9152_1 insolico UniProt ID   _
Length   773 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 773 a.a.        Molecular weight: 86636.63 Da        Isoelectric Point: 4.8571

>WP_301717990.1 type IV conjugative transfer system coupling protein TraD [Klebsiella michiganensis]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVLAAVVSLVICIVTFFVASWVLGCQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGQASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPMDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKVAEGFIQRTFDTRVDARLNALLAAREAEGSLARMLFTPDAPEAEQADQDSKAGAQHEPVKQPE
TAEGTVSPVPVTALSAAKTPAAEDPVKSPETLRPEVSDTRITTVPLIRTKPASSATGTAAAAAGVTAHTG
GTEQELAQQSADVGQEMMPAGMNEDGEIEDMQAYDAWLADELTQRDMQRREEVNINHSHRRDEQDDIEIG
GNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1802..17198

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Q0L46_RS28925 (Q0L46_28925) 1..1365 + 1365 Protein_0 DUF87 domain-containing protein -
Q0L46_RS28930 (Q0L46_28930) 1398..1805 + 408 WP_049071729 type-F conjugative transfer system protein TrbI -
Q0L46_RS28935 (Q0L46_28935) 1802..2428 + 627 WP_301719595 type-F conjugative transfer system protein TraW traW
Q0L46_RS28940 (Q0L46_28940) 2447..3430 + 984 WP_265829634 conjugal transfer pilus assembly protein TraU traU
Q0L46_RS28945 (Q0L46_28945) 3443..4060 + 618 WP_301717979 type-F conjugative transfer system pilin assembly protein TrbC trbC
Q0L46_RS28950 (Q0L46_28950) 4057..5931 + 1875 WP_301717980 type-F conjugative transfer system mating-pair stabilization protein TraN traN
Q0L46_RS28955 (Q0L46_28955) 5964..6245 + 282 WP_301717981 hypothetical protein -
Q0L46_RS28960 (Q0L46_28960) 6235..6468 + 234 WP_301717982 conjugal transfer protein TrbE -
Q0L46_RS28965 (Q0L46_28965) 6710..7036 + 327 WP_301717983 hypothetical protein -
Q0L46_RS28970 (Q0L46_28970) 7057..7809 + 753 WP_301717984 type-F conjugative transfer system pilin assembly protein TraF traF
Q0L46_RS28975 (Q0L46_28975) 7820..8059 + 240 WP_049071719 type-F conjugative transfer system pilin chaperone TraQ -
Q0L46_RS28980 (Q0L46_28980) 8031..8603 + 573 WP_301717985 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
Q0L46_RS28985 (Q0L46_28985) 8596..9024 + 429 WP_301717986 conjugal transfer protein TrbF -
Q0L46_RS28990 (Q0L46_28990) 9011..10381 + 1371 WP_301717987 conjugal transfer pilus assembly protein TraH traH
Q0L46_RS28995 (Q0L46_28995) 10381..13203 + 2823 WP_301717988 conjugal transfer mating-pair stabilization protein TraG traG
Q0L46_RS29000 (Q0L46_29000) 13219..13809 + 591 WP_301717989 hypothetical protein -
Q0L46_RS29005 (Q0L46_29005) 13951..14682 + 732 Protein_16 conjugal transfer complement resistance protein TraT -
Q0L46_RS29010 (Q0L46_29010) 14877..17198 + 2322 WP_301717990 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   14310 GenBank   NZ_CP129896
Plasmid name   pRSM9152_1 Incompatibility group   IncFII
Plasmid size   152910 bp Coordinate of oriT [Strand]   145135..145181 [-]
Host baterium   Klebsiella michiganensis strain 9152

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -