Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 113815 |
| Name | oriT_p2020C01-081-107k |
| Organism | Klebsiella variicola strain 2020C01-081 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP129758 (96433..96481 [-], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_p2020C01-081-107k
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 10270 | GenBank | WP_069985711 |
| Name | traD_QYQ59_RS29140_p2020C01-081-107k |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85951.95 Da Isoelectric Point: 5.0577
>WP_069985711.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPASGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLTDEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPASGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLTDEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 441..17058
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYQ59_RS29050 (QYQ59_29050) | 52..441 | + | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| QYQ59_RS29055 (QYQ59_29055) | 441..1097 | + | 657 | WP_301696431 | type-F conjugative transfer system protein TraW | traW |
| QYQ59_RS29060 (QYQ59_29060) | 1132..1533 | + | 402 | WP_004194979 | hypothetical protein | - |
| QYQ59_RS29065 (QYQ59_29065) | 1530..2519 | + | 990 | WP_029497420 | conjugal transfer pilus assembly protein TraU | traU |
| QYQ59_RS29070 (QYQ59_29070) | 2532..3170 | + | 639 | WP_069985712 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| QYQ59_RS29075 (QYQ59_29075) | 3229..5184 | + | 1956 | WP_030003482 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| QYQ59_RS29080 (QYQ59_29080) | 5216..5470 | + | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| QYQ59_RS29085 (QYQ59_29085) | 5448..5696 | + | 249 | WP_004152675 | hypothetical protein | - |
| QYQ59_RS29090 (QYQ59_29090) | 5709..6035 | + | 327 | WP_004152676 | hypothetical protein | - |
| QYQ59_RS29095 (QYQ59_29095) | 6056..6808 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| QYQ59_RS29100 (QYQ59_29100) | 6819..7058 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| QYQ59_RS29105 (QYQ59_29105) | 7030..7587 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| QYQ59_RS29110 (QYQ59_29110) | 7633..8076 | + | 444 | WP_004194305 | F-type conjugal transfer protein TrbF | - |
| QYQ59_RS29115 (QYQ59_29115) | 8054..9433 | + | 1380 | WP_014343487 | conjugal transfer pilus assembly protein TraH | traH |
| QYQ59_RS29120 (QYQ59_29120) | 9433..12282 | + | 2850 | WP_013609534 | conjugal transfer mating-pair stabilization protein TraG | traG |
| QYQ59_RS29125 (QYQ59_29125) | 12285..12818 | + | 534 | WP_014343486 | conjugal transfer protein TraS | - |
| QYQ59_RS29130 (QYQ59_29130) | 13004..13735 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| QYQ59_RS29135 (QYQ59_29135) | 13928..14617 | + | 690 | WP_072101983 | hypothetical protein | - |
| QYQ59_RS29140 (QYQ59_29140) | 14746..17058 | + | 2313 | WP_069985711 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 95875..102551
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYQ59_RS29555 (QYQ59_29555) | 90900..91250 | + | 351 | WP_023287104 | hypothetical protein | - |
| QYQ59_RS29560 (QYQ59_29560) | 91882..92238 | + | 357 | WP_019706019 | hypothetical protein | - |
| QYQ59_RS29565 (QYQ59_29565) | 92299..92511 | + | 213 | WP_019706020 | hypothetical protein | - |
| QYQ59_RS29570 (QYQ59_29570) | 92522..92746 | + | 225 | WP_014343499 | hypothetical protein | - |
| QYQ59_RS29575 (QYQ59_29575) | 92827..93147 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QYQ59_RS29580 (QYQ59_29580) | 93137..93415 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| QYQ59_RS29585 (QYQ59_29585) | 93416..93829 | + | 414 | WP_069985713 | type II toxin-antitoxin system HigA family antitoxin | - |
| QYQ59_RS29590 (QYQ59_29590) | 94659..95480 | + | 822 | WP_023287138 | DUF932 domain-containing protein | - |
| QYQ59_RS29595 (QYQ59_29595) | 95513..95842 | + | 330 | WP_071994324 | DUF5983 family protein | - |
| QYQ59_RS29600 (QYQ59_29600) | 95875..96360 | - | 486 | WP_032440470 | transglycosylase SLT domain-containing protein | virB1 |
| QYQ59_RS29605 (QYQ59_29605) | 96792..97184 | + | 393 | WP_004194114 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QYQ59_RS29610 (QYQ59_29610) | 97414..98115 | + | 702 | WP_004194113 | hypothetical protein | - |
| QYQ59_RS29615 (QYQ59_29615) | 98201..98401 | + | 201 | WP_004194116 | TraY domain-containing protein | - |
| QYQ59_RS29620 (QYQ59_29620) | 98470..98838 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| QYQ59_RS29625 (QYQ59_29625) | 98852..99157 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| QYQ59_RS29630 (QYQ59_29630) | 99177..99743 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| QYQ59_RS29635 (QYQ59_29635) | 99730..100470 | + | 741 | WP_013023821 | type-F conjugative transfer system secretin TraK | traK |
| QYQ59_RS29640 (QYQ59_29640) | 100470..101894 | + | 1425 | WP_004194260 | F-type conjugal transfer pilus assembly protein TraB | traB |
| QYQ59_RS29645 (QYQ59_29645) | 101967..102551 | + | 585 | WP_032440547 | type IV conjugative transfer system lipoprotein TraV | traV |
| QYQ59_RS29650 (QYQ59_29650) | 102874..103092 | + | 219 | WP_004195468 | hypothetical protein | - |
| QYQ59_RS29655 (QYQ59_29655) | 103093..103405 | + | 313 | Protein_125 | hypothetical protein | - |
| QYQ59_RS29660 (QYQ59_29660) | 103472..103876 | + | 405 | WP_004197817 | hypothetical protein | - |
| QYQ59_RS29665 (QYQ59_29665) | 104255..104653 | + | 399 | WP_023179972 | hypothetical protein | - |
Host bacterium
| ID | 14250 | GenBank | NZ_CP129758 |
| Plasmid name | p2020C01-081-107k | Incompatibility group | - |
| Plasmid size | 107299 bp | Coordinate of oriT [Strand] | 96433..96481 [-] |
| Host baterium | Klebsiella variicola strain 2020C01-081 |
Cargo genes
| Drug resistance gene | tet(D), blaSHV-5, aac(3)-IId, qnrS1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |