Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113729
Name   oriT_pSA20121591.1 in_silico
Organism   Salmonella enterica subsp. diarizonae serovar 48:i:z strain SA20121591
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP029990 (108526..108607 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)      44..49, 52..57  (CCGCGC..GCGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_pSA20121591.1
CGGGGTGTCGGGGCGAAGCCCTGACCAGGTGGTAAATGTATGGCCGCGCGTGCGCGGTTATACATTTACACATCCTGTCCCG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   8790 GenBank   WP_154715092
Name   nikB_DOE59_RS26240_pSA20121591.1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104089.34 Da        Isoelectric Point: 7.1711

>WP_154715092.1 MULTISPECIES: IncI1-type relaxase NikB [Salmonella]
MNAIIPKKRRDGKSSFEDLVSYVSVRDDVEDEELHALSSVQSELSHRSRFSRLVDYATRLRDESFVSLVD
VMKDGCEWVNFYGVTCFHNCTSLETAAEEMEYTARQARYAKDDTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKALGLPEHQYVSAVHTDTDNLHVHVAVNRVHPDTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
IHAPGNRIVRKTAVERDRQNAWKRGRKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQQNGS
FMVMDGWDRNHEGVQLDSFGPSWSGEKLRKKMGEYTPVPNDIFSQVVTPGRYKPEAVAADTRPEKITETE
SLMQYACRHTGERLPEMAREGQLESCQAIHRTLAEAGLWMRIQHGHLVICDGYDHNQTPVRADSVWSLLT
LENVKQLSGGWQPVPTDIFRQVTPTERFSGRRLENCPASDKEWHRMRTGTGPQGAIRRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLARAEP
QAGPFVSAPADLFDRVKPASRYNPELAVSDQSREDCRRDPVLRRQRREARAEARADLRARYLAWRDQWRK
PELRYGERSREIHQACRLRKSHIRVQYDDPVLRKLHYHIAEVQRMQALIRLKEEIRDERQKLIADGKWYP
PSYRQWVETQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTADRCVILCEPGGTPVYENRGDLEARLQKNGS
VRFRDRRSGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFERDPGMGFEPEGNDRQFNQVFAEMVAW
HNVTERTGHGDYTISRPDVDHHREGSERYYRDYINAHTGSDMSLTSPEQETHREPPSPL

  Protein domains


Predicted by InterproScan.

(63-315)


  Protein structure



No available structure.




Auxiliary protein


ID   5177 GenBank   WP_080102196
Name   WP_080102196_pSA20121591.1 insolico UniProt ID   _
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12699.58 Da        Isoelectric Point: 10.6646

>WP_080102196.1 MULTISPECIES: plasmid mobilization protein MobA [Salmonella]
MSDKRERSGSERRQKTLLRAVRFSPDEDEIIRKKAEDAGLTVSAYIRSAALNTRVNSRIDDKFLKELMRL
GRMQKHLFVEGKRTGDKEYASVLVAITELSNTVRKQLMEN

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP


ID   10189 GenBank   WP_253743163
Name   trbC_DOE59_RS26045_pSA20121591.1 insolico UniProt ID   _
Length   764 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 764 a.a.        Molecular weight: 86728.13 Da        Isoelectric Point: 7.9613

>WP_253743163.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Salmonella]
MSEHRVNPELIHRAAWGNPLWNALQTLNIYGLCLAGSLVVSFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLKCADPSQDRMIKRSLFSFWPTLFQYEVIKESPANGIFYVGYQRVRDIGRELWLNIDDLTRHIM
FFATTGGGKTETIFAWAINPLCWGRGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFVTQQSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNSLQRQDGIFGESWIDSPQISILMESKINVQELIELH
AGEFFSIFRGDTVPSTSFLIPDGEKSCSSDPVVINRYISVDAPRLDCLRRLVPRTAQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARERALWETAVNTLKTTTREERR
IRYITLNRPETSAADVEKKVSVITEKAGIRLLSPTEGDGLFNRIPDKKNSHISTIHRKGWNNRF

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 30037..65076

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DOE59_RS25850 (DOE59_27100) 25093..26160 + 1068 WP_154715048 TcpQ domain-containing protein -
DOE59_RS25855 (DOE59_27105) 26160..26597 + 438 WP_154715049 type IV pilus biogenesis protein PilM -
DOE59_RS25860 (DOE59_27110) 26611..28293 + 1683 WP_154715050 PilN family type IVB pilus formation outer membrane protein -
DOE59_RS25865 (DOE59_27115) 28286..29587 + 1302 WP_154715051 type 4b pilus protein PilO2 -
DOE59_RS25870 (DOE59_27120) 29574..30026 + 453 WP_154715052 type IV pilus biogenesis protein PilP -
DOE59_RS25875 (DOE59_27125) 30037..31590 + 1554 WP_080102248 GspE/PulE family protein virB11
DOE59_RS25880 (DOE59_27130) 31603..32700 + 1098 WP_114047669 type II secretion system F family protein -
DOE59_RS25885 (DOE59_27135) 32718..33335 + 618 WP_080102244 type 4 pilus major pilin -
DOE59_RS25890 (DOE59_27140) 33345..33905 + 561 WP_154715053 lytic transglycosylase domain-containing protein virB1
DOE59_RS25895 (DOE59_27145) 33890..34546 + 657 WP_114047666 A24 family peptidase -
DOE59_RS25900 (DOE59_27150) 34546..35874 + 1329 WP_080102286 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
DOE59_RS27260 (DOE59_27155) 36034..36126 + 93 Protein_46 shufflon-specific DNA recombinase -
DOE59_RS25905 (DOE59_27160) 36277..37101 + 825 WP_154715054 conjugal transfer protein TraE traE
DOE59_RS25910 (DOE59_27165) 37188..38390 + 1203 WP_154715055 conjugal transfer protein TraF -
DOE59_RS25915 (DOE59_27170) 38911..39366 + 456 WP_114047663 DotD/TraH family lipoprotein -
DOE59_RS25920 (DOE59_27175) 39363..40196 + 834 WP_080102237 type IV secretory system conjugative DNA transfer family protein traI
DOE59_RS25925 (DOE59_27180) 40340..41488 + 1149 WP_114047662 plasmid transfer ATPase TraJ virB11
DOE59_RS27045 (DOE59_27185) 41485..41775 + 291 WP_001838506 hypothetical protein traK
DOE59_RS25930 (DOE59_27190) 41790..42347 + 558 WP_154715056 phospholipase D family protein -
DOE59_RS25935 (DOE59_27195) 42627..46178 + 3552 WP_154715057 LPD7 domain-containing protein -
DOE59_RS25940 (DOE59_27200) 46196..46546 + 351 WP_080102233 conjugal transfer protein traL
DOE59_RS25945 (DOE59_27205) 46621..47244 + 624 WP_253743170 DotI/IcmL family type IV secretion protein traM
DOE59_RS25950 (DOE59_27210) 47260..48243 + 984 WP_154715058 DotH/IcmK family type IV secretion protein traN
DOE59_RS25955 (DOE59_27215) 48246..49547 + 1302 WP_154715059 conjugal transfer protein TraO traO
DOE59_RS25960 (DOE59_27220) 49544..50257 + 714 WP_080102230 conjugal transfer protein TraP traP
DOE59_RS25965 (DOE59_27225) 50257..50784 + 528 WP_080102229 conjugal transfer protein TraQ traQ
DOE59_RS25970 (DOE59_27230) 50827..51231 + 405 WP_080102228 DUF6750 family protein traR
DOE59_RS25975 (DOE59_27235) 51300..51488 + 189 WP_000556965 hypothetical protein -
DOE59_RS25980 (DOE59_27240) 51472..52272 + 801 WP_080102227 conjugal transfer protein TraT traT
DOE59_RS25985 (DOE59_27245) 52370..55414 + 3045 WP_154715060 ATP-binding protein traU
DOE59_RS25990 (DOE59_27250) 55414..56043 + 630 WP_154715061 conjugal transfer protein TraV -
DOE59_RS25995 (DOE59_27255) 56001..57203 + 1203 WP_154715062 conjugal transfer protein TraW traW
DOE59_RS26000 (DOE59_27260) 57200..57451 + 252 WP_154715063 hypothetical protein -
DOE59_RS26005 (DOE59_27265) 57444..58028 + 585 WP_154715064 conjugal transfer protein TraX -
DOE59_RS26010 (DOE59_27270) 58127..60298 + 2172 WP_154715065 DotA/TraY family protein traY
DOE59_RS26015 (DOE59_27275) 60331..60987 + 657 WP_154715066 plasmid IncI1-type surface exclusion protein ExcA -
DOE59_RS26020 (DOE59_27280) 61205..61414 + 210 WP_080102219 hemolysin expression modulator Hha -
DOE59_RS27115 61484..61579 - 96 WP_301337427 DinQ-like type I toxin DqlB -
DOE59_RS26025 (DOE59_27285) 61969..62283 - 315 WP_154715067 DNA-binding transcriptional regulator -
DOE59_RS26030 (DOE59_27290) 62276..62620 - 345 WP_080102217 toxin -
DOE59_RS26035 (DOE59_27295) 62768..63976 + 1209 WP_154715068 IncI1-type conjugal transfer protein TrbA trbA
DOE59_RS26040 (DOE59_27300) 63994..65076 + 1083 WP_154715069 DsbC family protein trbB
DOE59_RS26045 (DOE59_27305) 65069..67363 + 2295 WP_253743163 F-type conjugative transfer protein TrbC -
DOE59_RS26050 (DOE59_27310) 67450..67751 + 302 Protein_78 transposase -
DOE59_RS26055 (DOE59_27315) 67833..68636 - 804 WP_154715104 transporter substrate-binding domain-containing protein -
DOE59_RS26060 (DOE59_27320) 69254..69634 - 381 WP_154715070 hypothetical protein -
DOE59_RS26065 (DOE59_27325) 69686..70027 - 342 WP_080102214 DsrE family protein -


Host bacterium


ID   14164 GenBank   NZ_CP029990
Plasmid name   pSA20121591.1 Incompatibility group   IncB/O/K/Z
Plasmid size   121189 bp Coordinate of oriT [Strand]   108526..108607 [+]
Host baterium   Salmonella enterica subsp. diarizonae serovar 48:i:z strain SA20121591

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -