Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   113706
Name   oriT_pOXA-48_P7697 in_silico
Organism   Citrobacter freundii strain P7697
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP071835 (9009..9114 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pOXA-48_P7697
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   8776 GenBank   WP_004187323
Name   Relaxase_J3S87_RS24630_pOXA-48_P7697 insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP

ID   10168 GenBank   WP_004206885
Name   t4cp2_J3S87_RS24745_pOXA-48_P7697 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 11910..39252

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J3S87_RS24610 (J3S87_24465) 6994..7305 + 312 WP_004187333 hypothetical protein -
J3S87_RS24615 (J3S87_24470) 7438..7974 + 537 WP_004187332 hypothetical protein -
J3S87_RS24620 (J3S87_24475) 8476..8871 - 396 WP_019725163 hypothetical protein -
J3S87_RS24625 8906..9433 + 528 WP_172740549 plasmid mobilization protein MobA -
J3S87_RS24630 (J3S87_24485) 9420..11399 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
J3S87_RS24635 (J3S87_24490) 11413..11913 + 501 WP_004187320 DotD/TraH family lipoprotein -
J3S87_RS24640 (J3S87_24495) 11910..12689 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
J3S87_RS24645 (J3S87_24500) 12700..13863 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
J3S87_RS24650 (J3S87_24505) 13853..14113 + 261 WP_004187310 IcmT/TraK family protein traK
J3S87_RS24655 14138..17575 + 3438 WP_015586048 LPD7 domain-containing protein -
J3S87_RS24660 (J3S87_24515) 17541..18053 + 513 WP_011091071 hypothetical protein traL
J3S87_RS24665 (J3S87_24520) 18054..18266 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
J3S87_RS24670 (J3S87_24525) 18238..18648 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
J3S87_RS24675 (J3S87_24530) 18716..19429 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
J3S87_RS24680 (J3S87_24535) 19438..20589 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
J3S87_RS24685 (J3S87_24540) 20601..21950 + 1350 WP_004187474 conjugal transfer protein TraO traO
J3S87_RS24690 (J3S87_24545) 21962..22666 + 705 WP_015060002 conjugal transfer protein TraP traP
J3S87_RS24695 (J3S87_24550) 22690..23220 + 531 WP_004187478 conjugal transfer protein TraQ traQ
J3S87_RS24700 (J3S87_24555) 23237..23626 + 390 WP_004187479 DUF6750 family protein traR
J3S87_RS24705 (J3S87_24560) 23672..24166 + 495 WP_004187480 hypothetical protein -
J3S87_RS24710 (J3S87_24565) 24163..27213 + 3051 WP_004187482 hypothetical protein traU
J3S87_RS24715 (J3S87_24570) 27210..28418 + 1209 WP_011091082 conjugal transfer protein TraW traW
J3S87_RS24720 (J3S87_24575) 28415..29011 + 597 WP_015060003 hypothetical protein -
J3S87_RS24725 (J3S87_24580) 29004..31199 + 2196 WP_015062834 DotA/TraY family protein traY
J3S87_RS24730 (J3S87_24585) 31201..31854 + 654 WP_015060005 hypothetical protein -
J3S87_RS24735 (J3S87_24590) 31935..32165 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -
J3S87_RS27075 32414..32464 + 51 WP_011154478 IncL/M-type plasmid replication leader peptide RepB -
J3S87_RS24740 (J3S87_24595) 32461..33516 + 1056 WP_015060006 plasmid replication initiator RepA -
J3S87_RS27000 34738..34833 + 96 WP_004206884 DinQ-like type I toxin DqlB -
J3S87_RS24745 (J3S87_24600) 34884..36971 - 2088 WP_004206885 conjugal transfer protein TrbC -
J3S87_RS24750 (J3S87_24605) 36984..37934 - 951 WP_004206886 DsbC family protein trbB
J3S87_RS24755 (J3S87_24610) 37945..39252 - 1308 WP_015059988 hypothetical protein trbA
J3S87_RS24760 (J3S87_24615) 39252..39647 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
J3S87_RS24765 (J3S87_24620) 39752..40102 - 351 WP_124065455 DUF1496 domain-containing protein -
J3S87_RS24770 (J3S87_24625) 40215..40649 + 435 Protein_46 CPBP family intramembrane glutamate endopeptidase -
J3S87_RS24775 (J3S87_24630) 40664..41869 - 1206 WP_025987686 IS4-like element IS10A family transposase -
J3S87_RS24785 (J3S87_24640) 42782..43579 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -

Host bacterium

ID   14141 GenBank   NZ_CP071835
Plasmid name   pOXA-48_P7697 Incompatibility group   IncL/M
Plasmid size   63071 bp Coordinate of oriT [Strand]   9009..9114 [+]
Host baterium   Citrobacter freundii strain P7697

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -