Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   113632
Name   oriT_pEW1611 in_silico
Organism   Enterococcus casseliflavus strain EW1611
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OP852500 (28814..28851 [+], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      1..6, 10..15  (CTTTAC..GTAAAG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 38 nt

>oriT_pEW1611
CTTTACGAAGTAAAGTATAGTGGGTTATACTTTACATG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   8731 GenBank   WP_240016334
Name   Mob_Pre_QZJ70_RS00180_pEW1611 insolico UniProt ID   _
Length   272 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 272 a.a.        Molecular weight: 31505.73 Da        Isoelectric Point: 9.5623

>WP_240016334.1 MULTISPECIES: plasmid recombination protein [Enterococcus]
MHLGIVPFNAEKRLSAKTLFNRQALQAVQDELPKYLNERGFELERGEKGSERKNLTVPEYKKAKDELKEM
TTTLEQRKSEVLALSNDKTPTINKESLDLKDETKTVKVPSGETIGIGKLRHEFTKNEERKTGNVIIPESK
LNALIQGYEDLYKSNEQLKKYAETDLPKRIDYVKGKYKEVVRDYNDLADRFNNNLEKIDSLEKENKSLKN
EIKGIYRGFNQFMENTLGATVGQAKKLMNNLVSEIKEFVKGGEFEKIHRNETRTRDRDELSR

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-62)


  Protein structure



No available structure.




Host bacterium

ID   14067 GenBank   NZ_OP852500
Plasmid name   pEW1611 Incompatibility group   -
Plasmid size   35541 bp Coordinate of oriT [Strand]   28814..28851 [+]
Host baterium   Enterococcus casseliflavus strain EW1611

Cargo genes

Drug resistance gene   erm(B), cfr, optrA, aph(2'')-Ic, aadD, ant(9)-Ia, lnu(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -