Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 113598
• Name: oriT_MMP1|unnamed 2
• Organism: Staphylococcus warneri strain MMP1
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CM007784 (375..472 [-], 98 nt)
• oriT length: 98 nt
• IRs (inverted repeats): _
• Location of nic site: 66..67
• Conserved sequence flanking the nic site: GATTGGTCGC
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 98 nt

>oriT_MMP1|unnamed 2
TCAGCTGAAACTTTAAATATGAGTGTGCCTGCTTTCGTTAAGAAAAAGGCACAAGGCAGTCGATTGGTCGCACCTAAATTTGATAAAGAAACGCGACA

oriT secondary structure

Predicted by RNAfold.

Relaxase

Rep_trans_ATY33_RS00045_MMP1|unnamed 2

• ID: 8707
• GenBank: WP_002467289
• Name: Rep_trans_ATY33_RS00045_MMP1|unnamed 2
• UniProt ID: L0JHY5
• Length: 311 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 311 a.a.
• Molecular weight: 37667.01 Da
• Isoelectric Point: 8.9173

>WP_002467289.1 MULTISPECIES: replication initiation factor domain-containing protein [Bacteria]
MTKENHSNYLQNKGSDKFSKTGYSNSRLNRHTMYTPEPKISFDAMTIVGNLNKNNAQKLSEFMSVEPQIR
LWDILQTKFKAKALQEKVYIEYDKVKADTWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDYGFTRLDL
AFDFEDDLNDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEISSEHLWRV
EIELKRNMVDYWNDCFSDLHILQPDWKIIKRISDRAMVFMLLNEEEEWGKLERRTKNKYKQLIKEISPID
LTDLMKLTLRENEKQLQKQIDFWLSDFKIFK

Protein domains

Predicted by InterproScan.

• Replication initiation factor (Rep_trans) (135-294)

Protein structure

• AlphaFold DB: L0JHY5

Host bacterium

• ID: 14033
• GenBank: NZ_CM007784
• Plasmid name: MMP1|unnamed 2
• Incompatibility group: -
• Plasmid size: 4946 bp
• Coordinate of oriT [Strand]: 375..472 [-]
• Host baterium: Staphylococcus warneri strain MMP1

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -