Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 113596 |
| Name | oriT_pGX283-2  |
| Organism | Shigella sonnei strain GX283 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CM012292 (14609..14661 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pGX283-2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 10080 | GenBank | WP_290430170 |
| Name | t4cp2_ELR49_RS01120_pGX283-2 |
UniProt ID | _ |
| Length | 486 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 486 a.a. Molecular weight: 54933.19 Da Isoelectric Point: 9.5092
>WP_290430170.1 type IV secretory system conjugative DNA transfer family protein [Shigella sonnei]
MLYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQNAFSLRPPDTRKLSTRPLKDR
YALTAGILWIASVAVIYFVKRTWQKLPQSLSPASDDPIWSDSARNLFVGLGLYLLDKERFHLEQKAKGHN
VPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIETNFSSPLSIF
SNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHNPDLKYQCLI
LLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLYYPPKSKNAL
AKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNIAIREIITSE
FSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKSWLPEAM
MLYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQNAFSLRPPDTRKLSTRPLKDR
YALTAGILWIASVAVIYFVKRTWQKLPQSLSPASDDPIWSDSARNLFVGLGLYLLDKERFHLEQKAKGHN
VPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIETNFSSPLSIF
SNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHNPDLKYQCLI
LLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLYYPPKSKNAL
AKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNIAIREIITSE
FSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKSWLPEAM
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34330..51644
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ELR49_RS01040 (ELR49_24710) | 29896..31022 | - | 1127 | Protein_36 | site-specific integrase | - |
| ELR49_RS01045 (ELR49_24715) | 31161..31316 | + | 156 | WP_001358489 | hypothetical protein | - |
| ELR49_RS01070 (ELR49_24740) | 32468..33678 | - | 1211 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| ELR49_RS01075 (ELR49_24745) | 33691..34326 | - | 636 | WP_000934977 | A24 family peptidase | - |
| ELR49_RS01080 (ELR49_24750) | 34330..34812 | - | 483 | WP_127148751 | lytic transglycosylase domain-containing protein | virB1 |
| ELR49_RS01085 (ELR49_24755) | 34877..35434 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| ELR49_RS01090 (ELR49_24760) | 35479..36666 | - | 1188 | WP_290430153 | type II secretion system F family protein | - |
| ELR49_RS25240 | 36620..37186 | - | 567 | WP_171768917 | ATPase, T2SS/T4P/T4SS family | virB11 |
| ELR49_RS25245 | 37159..38115 | - | 957 | WP_171768918 | ATPase, T2SS/T4P/T4SS family | - |
| ELR49_RS01100 (ELR49_24770) | 38140..38634 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| ELR49_RS25780 | 38618..38905 | - | 288 | WP_290430154 | type 4b pilus protein PilO2 | - |
| ELR49_RS01105 (ELR49_24775) | 38872..39927 | - | 1056 | WP_290430155 | type 4b pilus protein PilO2 | - |
| ELR49_RS25785 | 39977..40987 | - | 1011 | WP_290430156 | PilN family type IVB pilus formation outer membrane protein | - |
| ELR49_RS25790 | 41144..41602 | - | 459 | WP_290430157 | hypothetical protein | - |
| ELR49_RS01115 (ELR49_24785) | 41612..42135 | - | 524 | Protein_50 | sigma 54-interacting transcriptional regulator | - |
| ELR49_RS01120 (ELR49_24790) | 42232..43692 | - | 1461 | WP_290430170 | type IV secretory system conjugative DNA transfer family protein | - |
| ELR49_RS25795 | 43750..44133 | - | 384 | WP_290430158 | hypothetical protein | - |
| ELR49_RS01125 (ELR49_24795) | 44153..45207 | - | 1055 | Protein_53 | P-type DNA transfer ATPase VirB11 | - |
| ELR49_RS25800 | 45226..45930 | - | 705 | WP_290430159 | TrbI/VirB10 family protein | virB10 |
| ELR49_RS25805 | 45906..46364 | - | 459 | WP_290430160 | hypothetical protein | - |
| ELR49_RS01135 (ELR49_24805) | 46354..47124 | - | 771 | WP_001542009 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| ELR49_RS01140 (ELR49_24810) | 47121..47762 | - | 642 | WP_072111987 | virB8 family protein | virB8 |
| ELR49_RS01150 (ELR49_24820) | 48017..50373 | - | 2357 | Protein_58 | conjugal transfer protein | - |
| ELR49_RS01155 (ELR49_24825) | 50379..50699 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| ELR49_RS25250 | 50770..51060 | - | 291 | WP_171768921 | conjugal transfer protein | - |
| ELR49_RS01165 (ELR49_24835) | 51060..51644 | - | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
| ELR49_RS01170 (ELR49_24840) | 51745..52062 | - | 318 | WP_249929349 | hypothetical protein | - |
| ELR49_RS01175 (ELR49_24845) | 52239..52619 | - | 381 | WP_290430161 | type IV pilus biogenesis protein PilM | - |
| ELR49_RS25810 | 52737..52859 | - | 123 | WP_290430171 | TcpQ domain-containing protein | - |
| ELR49_RS25815 | 53635..53856 | - | 222 | WP_290430162 | hypothetical protein | - |
| ELR49_RS01185 (ELR49_24855) | 53859..54158 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| ELR49_RS01190 (ELR49_24860) | 54225..54505 | - | 281 | Protein_67 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ELR49_RS01195 (ELR49_24865) | 54495..54745 | - | 251 | Protein_68 | plasmid stabilization protein | - |
| ELR49_RS01200 (ELR49_24870) | 54845..55480 | - | 636 | WP_022645136 | hypothetical protein | - |
| ELR49_RS01205 (ELR49_24875) | 55467..56318 | + | 852 | WP_290430163 | DUF5710 domain-containing protein | - |
Host bacterium
| ID | 14031 | GenBank | NZ_CM012292 |
| Plasmid name | pGX283-2 | Incompatibility group | IncI2 |
| Plasmid size | 63432 bp | Coordinate of oriT [Strand] | 14609..14661 [-] |
| Host baterium | Shigella sonnei strain GX283 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |