Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 113581 |
| Name | oriT_pSH272-1  |
| Organism | Shigella sonnei strain SH272-1 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MG299132 (15108..15160 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pSH272-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 10067 | GenBank | WP_039022943 |
| Name | t4cp2_HPG19_RS00240_pSH272-1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73293.90 Da Isoelectric Point: 9.1581
>WP_039022943.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQICSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQICSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 34314..58460
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPG19_RS00175 | 29639..30292 | - | 654 | WP_170855322 | hypothetical protein | - |
| HPG19_RS00180 | 30304..31428 | - | 1125 | WP_000486716 | site-specific integrase | - |
| HPG19_RS00410 | 31491..31712 | + | 222 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPG19_RS00190 | 32376..33662 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HPG19_RS00195 | 33675..34310 | - | 636 | WP_000934977 | A24 family peptidase | - |
| HPG19_RS00200 | 34314..34796 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HPG19_RS00205 | 34862..35419 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HPG19_RS00210 | 35464..36573 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HPG19_RS00215 | 36564..38102 | - | 1539 | WP_000466225 | GspE/PulE family protein | virB11 |
| HPG19_RS00220 | 38127..38621 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HPG19_RS00225 | 38605..39927 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HPG19_RS00230 | 39966..41609 | - | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
| HPG19_RS00235 | 41602..42126 | - | 525 | WP_001401691 | sigma 54-interacting transcriptional regulator | virb4 |
| HPG19_RS00240 | 42173..44131 | - | 1959 | WP_039022943 | type IV secretory system conjugative DNA transfer family protein | - |
| HPG19_RS00245 | 44147..45202 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| HPG19_RS00250 | 45221..46360 | - | 1140 | WP_001542008 | TrbI/VirB10 family protein | virB10 |
| HPG19_RS00255 | 46350..47051 | - | 702 | WP_049824867 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HPG19_RS00260 | 47117..47851 | - | 735 | WP_000432282 | virB8 family protein | virB8 |
| HPG19_RS00265 | 48017..50374 | - | 2358 | WP_065304451 | VirB4 family type IV secretion system protein | virb4 |
| HPG19_RS00270 | 50380..50700 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HPG19_RS00405 | 50771..51061 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HPG19_RS00280 | 51061..51645 | - | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
| HPG19_RS00285 | 51666..52064 | - | 399 | WP_001153669 | hypothetical protein | - |
| HPG19_RS00290 | 52183..52620 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HPG19_RS00295 | 52626..53861 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HPG19_RS00300 | 53864..54163 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HPG19_RS00305 | 54231..54512 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HPG19_RS00310 | 54502..54753 | - | 252 | WP_000121741 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| HPG19_RS00315 | 54853..55488 | - | 636 | WP_022645136 | hypothetical protein | - |
| HPG19_RS00320 | 55536..56327 | + | 792 | WP_022645137 | DUF5710 domain-containing protein | - |
| HPG19_RS00325 | 56582..56806 | - | 225 | WP_000713561 | EexN family lipoprotein | - |
| HPG19_RS00330 | 56815..57459 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| HPG19_RS00335 | 57465..58460 | - | 996 | WP_001028541 | type IV secretion system protein | virB6 |
| HPG19_RS00340 | 58464..58721 | - | 258 | WP_000739144 | hypothetical protein | - |
| HPG19_RS00345 | 58718..59071 | - | 354 | WP_023154634 | hypothetical protein | - |
| HPG19_RS00350 | 59291..59503 | - | 213 | WP_039022940 | hypothetical protein | - |
| HPG19_RS00355 | 59514..59684 | - | 171 | WP_000550720 | hypothetical protein | - |
| HPG19_RS00360 | 59688..60131 | - | 444 | WP_072037179 | NfeD family protein | - |
| HPG19_RS00365 | 60505..61458 | - | 954 | WP_072109880 | SPFH domain-containing protein | - |
| HPG19_RS00370 | 61485..61661 | - | 177 | WP_000753050 | hypothetical protein | - |
| HPG19_RS00375 | 61654..61869 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HPG19_RS00380 | 61862..62368 | - | 507 | WP_171265265 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 14016 | GenBank | NZ_MG299132 |
| Plasmid name | pSH272-1 | Incompatibility group | IncI2 |
| Plasmid size | 62958 bp | Coordinate of oriT [Strand] | 15108..15160 [-] |
| Host baterium | Shigella sonnei strain SH272-1 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |