Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113552
Name   oriT_pAR-0424-1 in_silico
Organism   Shigella flexneri strain AR-0424
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP044156 (77209..77560 [-], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      192..198, 206..212  (TATAAAA..TTTTATA)
 104..109, 119..124  (TTTAAA..TTTAAA)
 93..98, 106..111  (GATTTA..TAAATC)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_pAR-0424-1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACACTACGCAAAAACAAGTTTTTGCTGATTTATCTTTAATATCATTGAGTTGTATTTGTGGATTTATATTGTTTAAATCTGATTTTTTTAAAGCAGCGTCGTTAACGCAGCTACAGCAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGTCAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCACTATGAATTCTAGTGTTTCGAAATTAACTTTGTTTTATGTTTAAAAAAGGTAATATCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   10041 GenBank   WP_151106457
Name   traD_F4V36_RS23800_pAR-0424-1 insolico UniProt ID   _
Length   759 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 759 a.a.        Molecular weight: 86492.44 Da        Isoelectric Point: 5.2345

>WP_151106457.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Shigella]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIYWWCTSLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVSTGKSEVIRRLANYAR
KRGDMVVIYDRSCEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNVANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVVSMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVLNTRAFFRSPSHQIA
EFAAGEIGEKEHLKASLQYSYGADPVRDGVSTGKEMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQSQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEM
EQQLPPGISESGEVVDMAAYEAWQQENHPDIQQHMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(173-560)

(32-128)

  Protein structure



No available structure.



ID   10042 GenBank   WP_000069772
Name   traC_F4V36_RS23905_pAR-0424-1 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99344.15 Da        Isoelectric Point: 6.4096

>WP_000069772.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASFHGAKITTQTVDAQAFIEIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRTLKKLNVIDEGW
RLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLFPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRREG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(291-447)

(468-764)

(39-277)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 48676..78131

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F4V36_RS23800 48676..50955 - 2280 WP_151106457 type IV conjugative transfer system coupling protein TraD prgC
F4V36_RS23805 51006..51743 - 738 WP_012881122 hypothetical protein -
F4V36_RS23810 51946..52677 - 732 WP_012881123 conjugal transfer complement resistance protein TraT -
F4V36_RS23815 52691..53200 - 510 WP_000628111 conjugal transfer entry exclusion protein TraS -
F4V36_RS23820 53197..56022 - 2826 WP_033807963 conjugal transfer mating-pair stabilization protein TraG traG
F4V36_RS23825 56019..57391 - 1373 Protein_69 conjugal transfer pilus assembly protein TraH -
F4V36_RS23830 57378..57770 - 393 WP_000659962 F-type conjugal transfer protein TrbF -
F4V36_RS23835 57751..58098 - 348 WP_071571857 P-type conjugative transfer protein TrbJ -
F4V36_RS23840 58028..58572 - 545 Protein_72 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB -
F4V36_RS23845 58559..58843 - 285 WP_000624107 type-F conjugative transfer system pilin chaperone TraQ -
F4V36_RS23850 58924..59259 + 336 WP_001620807 hypothetical protein -
F4V36_RS23855 59240..59581 - 342 WP_000556795 conjugal transfer protein TrbA -
F4V36_RS23860 59595..60338 - 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
F4V36_RS23865 60331..60588 - 258 WP_033807961 conjugal transfer protein TrbE -
F4V36_RS23870 60615..62519 - 1905 WP_225620370 type-F conjugative transfer system mating-pair stabilization protein TraN traN
F4V36_RS23875 62755..63135 - 381 WP_001462111 hypothetical protein -
F4V36_RS23880 63132..63770 - 639 WP_033807960 type-F conjugative transfer system pilin assembly protein TrbC trbC
F4V36_RS23885 63779..64084 - 306 WP_000224418 hypothetical protein -
F4V36_RS23890 64114..65106 - 993 WP_000830849 conjugal transfer pilus assembly protein TraU traU
F4V36_RS23895 65103..65735 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
F4V36_RS23900 65732..66118 - 387 WP_000214084 type-F conjugative transfer system protein TrbI -
F4V36_RS23905 66115..68745 - 2631 WP_000069772 type IV secretion system protein TraC virb4
F4V36_RS23910 68871..69218 - 348 WP_000836682 hypothetical protein -
F4V36_RS23915 69246..69464 - 219 WP_033807959 hypothetical protein -
F4V36_RS23920 69563..70036 - 474 WP_033807958 hypothetical protein -
F4V36_RS23925 70029..70442 - 414 WP_000549589 hypothetical protein -
F4V36_RS23930 70435..70656 - 222 WP_001278683 conjugal transfer protein TraR -
F4V36_RS23935 70791..71306 - 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
F4V36_RS23940 71303..71623 - 321 WP_012881128 conjugal transfer protein TrbD -
F4V36_RS23945 71610..72200 - 591 WP_000002784 conjugal transfer pilus-stabilizing protein TraP -
F4V36_RS23950 72190..73617 - 1428 WP_033807957 F-type conjugal transfer pilus assembly protein TraB traB
F4V36_RS23955 73617..74345 - 729 WP_001230769 type-F conjugative transfer system secretin TraK traK
F4V36_RS23960 74332..74898 - 567 WP_000399780 type IV conjugative transfer system protein TraE traE
F4V36_RS23965 74920..75231 - 312 WP_000012113 type IV conjugative transfer system protein TraL traL
F4V36_RS23970 75246..75605 - 360 WP_001098994 type IV conjugative transfer system pilin TraA -
F4V36_RS23975 75639..75866 - 228 WP_000589556 conjugal transfer relaxosome protein TraY -
F4V36_RS23980 75986..76633 - 648 WP_000332523 transcriptional regulator TraJ family protein -
F4V36_RS23985 76825..77208 - 384 WP_001151529 conjugal transfer relaxosome DNA-binding protein TraM -
F4V36_RS23990 77541..78131 + 591 WP_000252683 transglycosylase SLT domain-containing protein virB1
F4V36_RS23995 78428..79249 - 822 WP_001234445 DUF932 domain-containing protein -
F4V36_RS24000 79360..79656 - 297 WP_001272251 hypothetical protein -


Host bacterium


ID   13987 GenBank   NZ_CP044156
Plasmid name   pAR-0424-1 Incompatibility group   -
Plasmid size   79831 bp Coordinate of oriT [Strand]   77209..77560 [-]
Host baterium   Shigella flexneri strain AR-0424

Cargo genes


Drug resistance gene   erm(B), mph(A), sul1, qacE, aadA5, blaTEM-1B
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -