Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 113457 |
| Name | oriT_pWL374-mcr-10 |
| Organism | Enterobacter roggenkampii strain WL374 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP128619 (80907..80955 [-], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pWL374-mcr-10
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 9961 | GenBank | WP_001568075 |
| Name | traD_QU521_RS24510_pWL374-mcr-10 |
UniProt ID | _ |
| Length | 735 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 735 a.a. Molecular weight: 82704.57 Da Isoelectric Point: 5.9222
>WP_001568075.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIASMRFRMFGQIANIILYVLFLFFWVLCGLILMYRLSWQTFVNGAVYWWCTTLGPMR
DIIRSQSVYTINYYGQQLQYTSEQILKDKYTIWCGEQLWTGFVFAGTVSLIICIVAFFVASWVLGHQGKQ
QSEDEVTGGRQLSEKPKEVARKMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSIDKILNPLDSRCAAWDLWKECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRSVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKGIA
EFAAGEIGEKEIKKASENYSYGADPVRDGVSTGKEQKRETIVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRQLNQAIDDKLAAVLAAREAEGQSARILFMPDPVETVPVEKTDEKPASPIAAVPTP
QEDKAKVPPVTASNTFHKPASAAAAAASASVTQAGGVEQELHEKPEEQLPLPPGVNKDGEIEDMNAWDEW
QSSSDVLRDMHRREEVNINHSHHVDRDDINLGSNF
MSFNAKDMTQGGQIASMRFRMFGQIANIILYVLFLFFWVLCGLILMYRLSWQTFVNGAVYWWCTTLGPMR
DIIRSQSVYTINYYGQQLQYTSEQILKDKYTIWCGEQLWTGFVFAGTVSLIICIVAFFVASWVLGHQGKQ
QSEDEVTGGRQLSEKPKEVARKMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSIDKILNPLDSRCAAWDLWKECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRSVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKGIA
EFAAGEIGEKEIKKASENYSYGADPVRDGVSTGKEQKRETIVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRQLNQAIDDKLAAVLAAREAEGQSARILFMPDPVETVPVEKTDEKPASPIAAVPTP
QEDKAKVPPVTASNTFHKPASAAAAAASASVTQAGGVEQELHEKPEEQLPLPPGVNKDGEIEDMNAWDEW
QSSSDVLRDMHRREEVNINHSHHVDRDDINLGSNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 80348..107679
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU521_RS24310 (QU521_24310) | 76342..76446 | - | 105 | Protein_80 | protein YdfV | - |
| QU521_RS24315 (QU521_24315) | 76471..76710 | + | 240 | WP_000534858 | type II toxin-antitoxin system antitoxin RelB | - |
| QU521_RS24320 (QU521_24320) | 76710..76997 | + | 288 | WP_000323025 | type II toxin-antitoxin system mRNA interferase RelE | - |
| QU521_RS24325 (QU521_24325) | 77064..78098 | - | 1035 | Protein_83 | IS481 family transposase | - |
| QU521_RS24835 | 78197..78259 | + | 63 | Protein_84 | hypothetical protein | - |
| QU521_RS24840 | 78231..78329 | + | 99 | Protein_85 | Hok/Gef family protein | - |
| QU521_RS24335 (QU521_24335) | 78591..78722 | - | 132 | WP_255344245 | hypothetical protein | - |
| QU521_RS24345 (QU521_24345) | 79120..79941 | + | 822 | WP_023332864 | DUF932 domain-containing protein | - |
| QU521_RS24350 (QU521_24350) | 80007..80315 | + | 309 | WP_023332865 | DUF5983 family protein | - |
| QU521_RS24355 (QU521_24355) | 80348..80833 | - | 486 | WP_032629900 | transglycosylase SLT domain-containing protein | virB1 |
| QU521_RS24360 (QU521_24360) | 81256..81642 | + | 387 | WP_001568107 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QU521_RS24365 (QU521_24365) | 81862..82551 | + | 690 | WP_001568106 | helix-turn-helix domain-containing protein | - |
| QU521_RS24370 (QU521_24370) | 82726..82890 | + | 165 | WP_071594636 | TraY domain-containing protein | - |
| QU521_RS24375 (QU521_24375) | 82969..83337 | + | 369 | WP_001568105 | type IV conjugative transfer system pilin TraA | - |
| QU521_RS24380 (QU521_24380) | 83417..83785 | + | 369 | WP_001568104 | type IV conjugative transfer system pilin TraA | - |
| QU521_RS24385 (QU521_24385) | 83799..84104 | + | 306 | WP_024191986 | type IV conjugative transfer system protein TraL | traL |
| QU521_RS24390 (QU521_24390) | 84123..84689 | + | 567 | WP_001568102 | type IV conjugative transfer system protein TraE | traE |
| QU521_RS24395 (QU521_24395) | 84676..85416 | + | 741 | WP_001568101 | type-F conjugative transfer system secretin TraK | traK |
| QU521_RS24400 (QU521_24400) | 85416..86828 | + | 1413 | WP_001568100 | F-type conjugal transfer pilus assembly protein TraB | traB |
| QU521_RS24405 (QU521_24405) | 86821..87057 | + | 237 | WP_001568098 | hypothetical protein | virb4 |
| QU521_RS24410 (QU521_24410) | 87076..87645 | + | 570 | WP_001568094 | type IV conjugative transfer system lipoprotein TraV | traV |
| QU521_RS24415 (QU521_24415) | 87759..88172 | + | 414 | WP_001568093 | hypothetical protein | - |
| QU521_RS24420 (QU521_24420) | 88177..88575 | + | 399 | WP_001568092 | hypothetical protein | - |
| QU521_RS24425 (QU521_24425) | 89038..89820 | + | 783 | Protein_103 | TraC family protein | - |
| QU521_RS24430 (QU521_24430) | 89892..91054 | + | 1163 | WP_085947771 | IS3-like element IS3 family transposase | - |
| QU521_RS24435 (QU521_24435) | 91097..92938 | + | 1842 | Protein_105 | type IV secretion system protein TraC | - |
| QU521_RS24440 (QU521_24440) | 92938..93315 | + | 378 | WP_001568089 | type-F conjugative transfer system protein TrbI | - |
| QU521_RS24445 (QU521_24445) | 93312..93941 | + | 630 | WP_001568088 | type-F conjugative transfer system protein TraW | traW |
| QU521_RS24450 (QU521_24450) | 93973..94944 | + | 972 | WP_176602138 | conjugal transfer pilus assembly protein TraU | traU |
| QU521_RS24455 (QU521_24455) | 94957..95583 | + | 627 | WP_001568086 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| QU521_RS24460 (QU521_24460) | 95580..97472 | + | 1893 | Protein_110 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| QU521_RS24465 (QU521_24465) | 97485..97745 | + | 261 | WP_001568084 | conjugal transfer protein TrbE | - |
| QU521_RS24470 (QU521_24470) | 97742..98074 | + | 333 | WP_001568083 | hypothetical protein | - |
| QU521_RS24475 (QU521_24475) | 98090..98839 | + | 750 | WP_001568082 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| QU521_RS24480 (QU521_24480) | 98850..99083 | + | 234 | WP_001568081 | type-F conjugative transfer system pilin chaperone TraQ | - |
| QU521_RS24485 (QU521_24485) | 99103..99639 | + | 537 | WP_032160235 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| QU521_RS24490 (QU521_24490) | 99626..100996 | + | 1371 | WP_023332869 | conjugal transfer pilus assembly protein TraH | traH |
| QU521_RS24495 (QU521_24495) | 100996..103845 | + | 2850 | WP_001568078 | conjugal transfer mating-pair stabilization protein TraG | traG |
| QU521_RS24500 (QU521_24500) | 103851..104378 | + | 528 | WP_024191983 | conjugal transfer protein TraS | - |
| QU521_RS24505 (QU521_24505) | 104556..105287 | + | 732 | WP_001568076 | conjugal transfer complement resistance protein TraT | - |
| QU521_RS24510 (QU521_24510) | 105472..107679 | + | 2208 | WP_001568075 | type IV conjugative transfer system coupling protein TraD | virb4 |
| QU521_RS24515 (QU521_24515) | 107679..108236 | + | 558 | Protein_121 | MobF family relaxase | - |
| QU521_RS24520 (QU521_24520) | 108529..108882 | + | 354 | WP_001114073 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| QU521_RS24525 (QU521_24525) | 108930..109292 | + | 363 | WP_000783215 | arsenite efflux transporter metallochaperone ArsD | - |
| QU521_RS24530 (QU521_24530) | 109310..111061 | + | 1752 | WP_289784018 | arsenite efflux transporter ATPase subunit ArsA | - |
| QU521_RS24535 (QU521_24535) | 111110..112399 | + | 1290 | WP_000922630 | arsenite efflux transporter membrane subunit ArsB | - |
Host bacterium
| ID | 13892 | GenBank | NZ_CP128619 |
| Plasmid name | pWL374-mcr-10 | Incompatibility group | IncFIA |
| Plasmid size | 125908 bp | Coordinate of oriT [Strand] | 80907..80955 [-] |
| Host baterium | Enterobacter roggenkampii strain WL374 |
Cargo genes
| Drug resistance gene | mcr-10 |
| Virulence gene | - |
| Metal resistance gene | terW, terZ, terA, terB, terC, terD, terE, arsR, arsD, arsA, arsB, arsC |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |