Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   113271
Name   oriT_pRM106_1 in_silico
Organism   Salmonella enterica subsp. enterica serovar Saintpaul strain RM106
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117328 (59192..59280 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pRM106_1
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTGATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   8515 GenBank   WP_274891448
Name   nikB_PQP95_RS23115_pRM106_1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103913.35 Da        Isoelectric Point: 7.3373

>WP_274891448.1 IncI1-type relaxase NikB [Salmonella enterica]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRSRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure



No available structure.




Auxiliary protein

ID   4917 GenBank   WP_001283947
Name   WP_001283947_pRM106_1 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   9828 GenBank   WP_001289282
Name   trbC_PQP95_RS23120_pRM106_1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86969.12 Da        Isoelectric Point: 6.7713

>WP_001289282.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMARLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 64658..104158

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP95_RS23120 (PQP95_23120) 62374..64665 - 2292 WP_001289282 F-type conjugative transfer protein TrbC -
PQP95_RS23125 (PQP95_23125) 64658..65728 - 1071 WP_000151582 IncI1-type conjugal transfer protein TrbB trbB
PQP95_RS23130 (PQP95_23130) 65747..66955 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
PQP95_RS23135 (PQP95_23135) 67262..68041 - 780 WP_275450201 protein FinQ -
PQP95_RS23140 (PQP95_23140) 68668..68820 + 153 WP_001303307 Hok/Gef family protein -
PQP95_RS23145 (PQP95_23145) 68892..69143 - 252 WP_001291965 hypothetical protein -
PQP95_RS23150 (PQP95_23150) 70067..70243 - 177 WP_001054900 hypothetical protein -
PQP95_RS23155 (PQP95_23155) 70452..70661 - 210 WP_001140545 hemolysin expression modulator Hha -
PQP95_RS23160 (PQP95_23160) 70759..71373 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
PQP95_RS23165 (PQP95_23165) 71449..73617 - 2169 WP_000698360 IncI1-type conjugal transfer membrane protein TraY traY
PQP95_RS23170 (PQP95_23170) 73714..74298 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
PQP95_RS23175 (PQP95_23175) 74327..75529 - 1203 WP_001189159 IncI1-type conjugal transfer protein TraW traW
PQP95_RS23180 (PQP95_23180) 75496..76110 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
PQP95_RS23185 (PQP95_23185) 76110..79154 - 3045 WP_001024752 IncI1-type conjugal transfer protein TraU traU
PQP95_RS23190 (PQP95_23190) 79244..80044 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
PQP95_RS23195 (PQP95_23195) 80028..80216 - 189 WP_001277255 putative conjugal transfer protein TraS -
PQP95_RS23200 (PQP95_23200) 80280..80684 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
PQP95_RS23205 (PQP95_23205) 80735..81262 - 528 WP_001055569 conjugal transfer protein TraQ traQ
PQP95_RS23210 (PQP95_23210) 81262..81966 - 705 WP_274891452 IncI1-type conjugal transfer protein TraP traP
PQP95_RS23215 (PQP95_23215) 81966..83255 - 1290 WP_001271997 conjugal transfer protein TraO traO
PQP95_RS23220 (PQP95_23220) 83258..84241 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
PQP95_RS23225 (PQP95_23225) 84252..84944 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
PQP95_RS23230 (PQP95_23230) 84941..85288 - 348 WP_001055900 conjugal transfer protein traL
PQP95_RS23235 (PQP95_23235) 85306..89073 - 3768 WP_001141534 LPD7 domain-containing protein -
PQP95_RS23240 (PQP95_23240) 89163..89714 - 552 WP_000014584 phospholipase D family protein -
PQP95_RS23245 (PQP95_23245) 89729..90019 - 291 WP_001299214 hypothetical protein traK
PQP95_RS23250 (PQP95_23250) 90016..91164 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
PQP95_RS23255 (PQP95_23255) 91161..91979 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
PQP95_RS23260 (PQP95_23260) 91976..92434 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
PQP95_RS23265 (PQP95_23265) 92829..93413 - 585 WP_137559097 histidine phosphatase family protein -
PQP95_RS23270 (PQP95_23270) 93473..94675 - 1203 WP_000976353 conjugal transfer protein TraF -
PQP95_RS23275 (PQP95_23275) 94761..95585 - 825 WP_001238927 conjugal transfer protein TraE traE
PQP95_RS23280 (PQP95_23280) 95736..96890 - 1155 WP_001139958 tyrosine-type recombinase/integrase -
PQP95_RS23285 (PQP95_23285) 98375..99652 - 1278 WP_274891461 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
PQP95_RS23290 (PQP95_23290) 99652..100308 - 657 WP_001389386 prepilin peptidase -
PQP95_RS23295 (PQP95_23295) 100293..100853 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
PQP95_RS23300 (PQP95_23300) 100863..101477 - 615 WP_000959786 type 4 pilus major pilin -
PQP95_RS23305 (PQP95_23305) 101495..102592 - 1098 WP_274891462 type II secretion system F family protein -
PQP95_RS23310 (PQP95_23310) 102605..104158 - 1554 WP_274891463 GspE/PulE family protein virB11
PQP95_RS23315 (PQP95_23315) 104169..104621 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
PQP95_RS23320 (PQP95_23320) 104608..105903 - 1296 WP_000752772 type 4b pilus protein PilO2 -
PQP95_RS23325 (PQP95_23325) 105896..107578 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
PQP95_RS23330 (PQP95_23330) 107592..108029 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
PQP95_RS23335 (PQP95_23335) 108029..109096 - 1068 WP_001302629 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   13706 GenBank   NZ_CP117328
Plasmid name   pRM106_1 Incompatibility group   IncI1
Plasmid size   114639 bp Coordinate of oriT [Strand]   59192..59280 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Saintpaul strain RM106

Cargo genes

Drug resistance gene   floR, tet(A), aph(6)-Id, aph(3'')-Ib, sul2, blaTEM-1A
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2