Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113250
Name   oriT_pRM101_2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg strain RM101
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117350 (32292..32380 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pRM101_2
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   8500 GenBank   WP_010891268
Name   nikB_PQQ11_RS24425_pRM101_2 insolico UniProt ID   A0A632VGA6
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103977.42 Da        Isoelectric Point: 7.2753

>WP_010891268.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYIAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFLQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A632VGA6


Auxiliary protein


ID   4900 GenBank   WP_001283947
Name   WP_001283947_pRM101_2 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP


ID   9808 GenBank   WP_001289276
Name   trbC_PQQ11_RS24430_pRM101_2 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 37758..75708

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ11_RS24430 (PQQ11_24430) 35474..37765 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
PQQ11_RS24435 (PQQ11_24435) 37758..38828 - 1071 WP_274898323 IncI1-type conjugal transfer protein TrbB trbB
PQQ11_RS24440 (PQQ11_24440) 38847..40055 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
PQQ11_RS24445 (PQQ11_24445) 40347..40499 + 153 WP_001303307 Hok/Gef family protein -
PQQ11_RS24450 (PQQ11_24450) 40571..40822 - 252 WP_001291964 hypothetical protein -
PQQ11_RS24455 (PQQ11_24455) 41321..41416 + 96 WP_001303310 DinQ-like type I toxin DqlB -
PQQ11_RS24460 (PQQ11_24460) 41481..41657 - 177 WP_001054904 hypothetical protein -
PQQ11_RS24465 (PQQ11_24465) 42049..42258 + 210 WP_000062603 HEAT repeat domain-containing protein -
PQQ11_RS24470 (PQQ11_24470) 42330..42980 - 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
PQQ11_RS24475 (PQQ11_24475) 43054..45222 - 2169 WP_000698357 DotA/TraY family protein traY
PQQ11_RS24480 (PQQ11_24480) 45319..45903 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
PQQ11_RS24485 (PQQ11_24485) 45932..47134 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
PQQ11_RS24490 (PQQ11_24490) 47101..47715 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
PQQ11_RS24495 (PQQ11_24495) 47715..50759 - 3045 WP_274898310 IncI1-type conjugal transfer protein TraU traU
PQQ11_RS24500 (PQQ11_24500) 50849..51649 - 801 WP_274898311 IncI1-type conjugal transfer protein TraT traT
PQQ11_RS24505 (PQQ11_24505) 51633..51821 - 189 WP_001277255 putative conjugal transfer protein TraS -
PQQ11_RS24510 (PQQ11_24510) 51885..52289 - 405 WP_000086959 IncI1-type conjugal transfer protein TraR traR
PQQ11_RS24515 (PQQ11_24515) 52340..52867 - 528 WP_001055569 conjugal transfer protein TraQ traQ
PQQ11_RS24520 (PQQ11_24520) 52867..53571 - 705 WP_274898312 IncI1-type conjugal transfer protein TraP traP
PQQ11_RS24525 (PQQ11_24525) 53571..54860 - 1290 WP_001272000 conjugal transfer protein TraO traO
PQQ11_RS24530 (PQQ11_24530) 54863..55846 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
PQQ11_RS24535 (PQQ11_24535) 55857..56549 - 693 WP_000138551 DotI/IcmL family type IV secretion protein traM
PQQ11_RS24540 (PQQ11_24540) 56546..56893 - 348 WP_001055900 conjugal transfer protein traL
PQQ11_RS24545 (PQQ11_24545) 56911..60678 - 3768 WP_001141541 LPD7 domain-containing protein -
PQQ11_RS24550 (PQQ11_24550) 60768..61319 - 552 WP_000014584 phospholipase D family protein -
PQQ11_RS24555 (PQQ11_24555) 61334..61624 - 291 WP_001372180 hypothetical protein traK
PQQ11_RS24560 (PQQ11_24560) 61621..62769 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
PQQ11_RS24565 (PQQ11_24565) 62766..63584 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
PQQ11_RS24570 (PQQ11_24570) 63581..64039 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
PQQ11_RS24575 (PQQ11_24575) 64434..65018 - 585 WP_000977522 histidine phosphatase family protein -
PQQ11_RS24580 (PQQ11_24580) 65078..66280 - 1203 WP_000976353 conjugal transfer protein TraF -
PQQ11_RS24585 (PQQ11_24585) 66366..67190 - 825 WP_001238929 conjugal transfer protein TraE traE
PQQ11_RS24590 (PQQ11_24590) 67341..68493 - 1153 Protein_76 site-specific integrase -
PQQ11_RS24595 (PQQ11_24595) 68492..68791 + 300 WP_274898313 hypothetical protein -
PQQ11_RS24600 (PQQ11_24600) 69972..71204 - 1233 WP_274898314 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
PQQ11_RS24605 (PQQ11_24605) 71204..71860 - 657 WP_001193553 prepilin peptidase -
PQQ11_RS24610 (PQQ11_24610) 71845..72363 - 519 WP_236920224 lytic transglycosylase domain-containing protein virB1
PQQ11_RS24615 (PQQ11_24615) 72414..73028 - 615 WP_000959786 type 4 pilus major pilin -
PQQ11_RS24620 (PQQ11_24620) 73046..74142 - 1097 Protein_82 type II secretion system F family protein -
PQQ11_RS24625 (PQQ11_24625) 74155..75708 - 1554 WP_000362202 GspE/PulE family protein virB11
PQQ11_RS24630 (PQQ11_24630) 75719..76171 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
PQQ11_RS24635 (PQQ11_24635) 76158..77453 - 1296 WP_000752772 type 4b pilus protein PilO2 -
PQQ11_RS24640 (PQQ11_24640) 77446..79128 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
PQQ11_RS24645 (PQQ11_24645) 79142..79579 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
PQQ11_RS24650 (PQQ11_24650) 79579..80646 - 1068 WP_001302629 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   13685 GenBank   NZ_CP117350
Plasmid name   pRM101_2 Incompatibility group   IncI1
Plasmid size   86233 bp Coordinate of oriT [Strand]   32292..32380 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg strain RM101

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -