Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   113232
Name   oriT_pRM002_1 in_silico
Organism   Salmonella enterica subsp. enterica serovar Derby strain RM002
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117318 (33521..33609 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pRM002_1
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   8491 GenBank   WP_274881822
Name   nikB_PQQ14_RS23700_pRM002_1 insolico UniProt ID   _
Length   898 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 898 a.a.        Molecular weight: 103840.27 Da        Isoelectric Point: 7.6059

>WP_274881822.1 IncI1-type relaxase NikB [Salmonella enterica]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSQAEQPHRSRFSRLVDYATRLRNESFVALVDV
MKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVRH
TLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCWV
HAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQKDGKF
LVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETES
LQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLTL
DNVNQLDGGWQPVPTDIFRQVTPTERFRGRRRESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGYS
ISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEPQ
AGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRKP
DLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYPP
SYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGSV
RFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAWH
NVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(61-313)


  Protein structure



No available structure.




Auxiliary protein


ID   4891 GenBank   WP_001283947
Name   WP_001283947_pRM002_1 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP


ID   9797 GenBank   WP_274881823
Name   trbC_PQQ14_RS23705_pRM002_1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 87003.18 Da        Isoelectric Point: 6.7712

>WP_274881823.1 F-type conjugative transfer protein TrbC [Salmonella enterica]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKYNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 38984..77950

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ14_RS23705 (PQQ14_23705) 36700..38991 - 2292 WP_274881823 F-type conjugative transfer protein TrbC -
PQQ14_RS23710 (PQQ14_23710) 38984..40054 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
PQQ14_RS23715 (PQQ14_23715) 40073..41281 - 1209 WP_039005623 IncI1-type conjugal transfer protein TrbA trbA
PQQ14_RS23720 (PQQ14_23720) 41573..41725 + 153 WP_001331364 Hok/Gef family protein -
PQQ14_RS23725 (PQQ14_23725) 41797..42048 - 252 WP_001291964 hypothetical protein -
PQQ14_RS23730 (PQQ14_23730) 42549..42644 + 96 WP_000609148 DinQ-like type I toxin DqlB -
PQQ14_RS23735 (PQQ14_23735) 42709..42885 - 177 WP_001054904 hypothetical protein -
PQQ14_RS23740 (PQQ14_23740) 43277..43486 + 210 WP_000062603 HEAT repeat domain-containing protein -
PQQ14_RS23745 (PQQ14_23745) 43558..44220 - 663 WP_012783935 plasmid IncI1-type surface exclusion protein ExcA -
PQQ14_RS23750 (PQQ14_23750) 44291..46459 - 2169 WP_023518847 DotA/TraY family protein traY
PQQ14_RS23755 (PQQ14_23755) 46556..47140 - 585 WP_052896781 IncI1-type conjugal transfer protein TraX -
PQQ14_RS23760 (PQQ14_23760) 47169..48371 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
PQQ14_RS23765 (PQQ14_23765) 48338..48952 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
PQQ14_RS23770 (PQQ14_23770) 48952..51996 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
PQQ14_RS23775 (PQQ14_23775) 52086..52886 - 801 WP_274881765 IncI1-type conjugal transfer protein TraT traT
PQQ14_RS23780 (PQQ14_23780) 52870..53058 - 189 WP_052896789 putative conjugal transfer protein TraS -
PQQ14_RS23785 (PQQ14_23785) 53122..53526 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
PQQ14_RS23790 (PQQ14_23790) 53577..54104 - 528 WP_001055569 conjugal transfer protein TraQ traQ
PQQ14_RS23795 (PQQ14_23795) 54104..54808 - 705 WP_274881768 IncI1-type conjugal transfer protein TraP traP
PQQ14_RS23800 (PQQ14_23800) 54808..56097 - 1290 WP_001271994 conjugal transfer protein TraO traO
PQQ14_RS23805 (PQQ14_23805) 56100..57083 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
PQQ14_RS23810 (PQQ14_23810) 57094..57786 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
PQQ14_RS23815 (PQQ14_23815) 57783..58130 - 348 WP_001055900 conjugal transfer protein traL
PQQ14_RS23820 (PQQ14_23820) 58148..61915 - 3768 WP_052896792 LPD7 domain-containing protein -
PQQ14_RS23825 (PQQ14_23825) 62005..62556 - 552 WP_000014584 phospholipase D family protein -
PQQ14_RS23830 (PQQ14_23830) 62571..62861 - 291 WP_072107178 conjugal transfer protein traK
PQQ14_RS23835 (PQQ14_23835) 62858..64006 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
PQQ14_RS23840 (PQQ14_23840) 64003..64821 - 819 WP_000866663 IncI1-type conjugal transfer lipoprotein TraI traI
PQQ14_RS23845 (PQQ14_23845) 64818..65276 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
PQQ14_RS23850 (PQQ14_23850) 65671..66255 - 585 WP_016231299 histidine phosphatase family protein -
PQQ14_RS23855 (PQQ14_23855) 66315..67517 - 1203 WP_000976353 conjugal transfer protein TraF -
PQQ14_RS23860 (PQQ14_23860) 67602..68426 - 825 WP_001582597 conjugal transfer protein TraE traE
PQQ14_RS23865 (PQQ14_23865) 68577..69731 - 1155 WP_001139958 tyrosine-type recombinase/integrase -
PQQ14_RS24130 71808..72050 + 243 Protein_82 hypothetical protein -
PQQ14_RS23870 (PQQ14_23870) 72321..73469 - 1149 WP_353739098 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
PQQ14_RS23875 (PQQ14_23875) 73457..74113 - 657 WP_001193549 A24 family peptidase -
PQQ14_RS23880 (PQQ14_23880) 74098..74658 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
PQQ14_RS23885 (PQQ14_23885) 74668..75282 - 615 WP_000908226 type 4 pilus major pilin -
PQQ14_RS23890 (PQQ14_23890) 75299..76384 - 1086 WP_274881791 type II secretion system F family protein -
PQQ14_RS23895 (PQQ14_23895) 76397..77950 - 1554 WP_274881792 GspE/PulE family protein virB11
PQQ14_RS23900 (PQQ14_23900) 77961..78413 - 453 WP_001247337 type IV pilus biogenesis protein PilP -
PQQ14_RS23905 (PQQ14_23905) 78400..79695 - 1296 WP_000752780 type 4b pilus protein PilO2 -
PQQ14_RS23910 (PQQ14_23910) 79688..81370 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
PQQ14_RS23915 (PQQ14_23915) 81384..81821 - 438 WP_274881793 type IV pilus biogenesis protein PilM -
PQQ14_RS23920 (PQQ14_23920) 81821..82888 - 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   13667 GenBank   NZ_CP117318
Plasmid name   pRM002_1 Incompatibility group   IncI1
Plasmid size   87713 bp Coordinate of oriT [Strand]   33521..33609 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Derby strain RM002

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -