Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   113205
Name   oriT_pRM001_1 in_silico
Organism   Salmonella enterica subsp. enterica serovar Derby strain RM001
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117323 (8796..8855 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pRM001_1
GGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   8472 GenBank   WP_274900954
Name   Relaxase_PQP82_RS23655_pRM001_1 insolico UniProt ID   _
Length   93 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 93 a.a.        Molecular weight: 11269.97 Da        Isoelectric Point: 11.3621

>WP_274900954.1 relaxase/mobilization nuclease domain-containing protein [Salmonella enterica]
MEHQDKGRLELNFVIPNMELASGKRLQPYYDRADRPRINAWQTLVNHHYGLHDPNAPENRRTLVTPIIIC
RKRNRRPQKRLRGDWRLFTMPER

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(2-64)


  Protein structure



No available structure.




Auxiliary protein

ID   4876 GenBank   WP_001444404
Name   WP_001444404_pRM001_1 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11855.62 Da        Isoelectric Point: 10.1917

>WP_001444404.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTIRVTDEEHARLLARCEGKQLASWMRKVCLGAPPSKTSGLPTLAPPLLRQFASVGNNLNQIARKINSG
QWSGHDRVHVVAALMAIGRELSELRDEVRKQGERDDS

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   13640 GenBank   NZ_CP117323
Plasmid name   pRM001_1 Incompatibility group   ColRNAI
Plasmid size   11944 bp Coordinate of oriT [Strand]   8796..8855 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Derby strain RM001

Cargo genes

Drug resistance gene   sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -