Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   113031
Name   oriT_pST34VN4 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium strain 02_1206
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OQ658822 (93600..93750 [-], 151 nt)
oriT length   151 nt
IRs (inverted repeats)      93..98, 106..111  (TGGCCT..AGGCCA)
 12..17, 24..29  (AACCCT..AGGGTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 151 nt

>oriT_pST34VN4
TGGTCGATGTGAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACATCCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTGCTACATCACAGACGGGATTAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   8367 GenBank   WP_001337757
Name   mobH_QTM65_RS00595_pST34VN4 insolico UniProt ID   A0A709FRI2
Length   992 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>WP_001337757.1 MULTISPECIES: MobH family relaxase [Gammaproteobacteria]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB A0A709FRI2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 70475..95666

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTM65_RS00450 (pVN4_00440) 65602..66510 - 909 WP_000739139 hypothetical protein -
QTM65_RS00455 (pVN4_00445) 66521..67489 - 969 WP_000085162 AAA family ATPase -
QTM65_RS00460 (pVN4_00450) 67709..67894 - 186 WP_001186917 hypothetical protein -
QTM65_RS00465 (pVN4_00460) 68198..68518 - 321 WP_000547566 hypothetical protein -
QTM65_RS00470 (pVN4_00465) 68812..69453 + 642 WP_000796664 hypothetical protein -
QTM65_RS00475 (pVN4_00470) 69576..70436 + 861 WP_000709517 hypothetical protein -
QTM65_RS00480 (pVN4_00475) 70475..73273 - 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
QTM65_RS00485 (pVN4_00480) 73389..74393 - 1005 WP_043940352 TraU family protein traU
QTM65_RS00490 (pVN4_00485) 74393..75064 - 672 WP_001337754 EAL domain-containing protein -
QTM65_RS00495 (pVN4_00490) 75061..76326 - 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
QTM65_RS00500 (pVN4_00495) 76289..76819 - 531 WP_001010738 S26 family signal peptidase -
QTM65_RS00505 (pVN4_00500) 76816..77133 - 318 WP_000351984 hypothetical protein -
QTM65_RS00510 (pVN4_00505) 77148..79595 - 2448 WP_000637386 type IV secretion system protein TraC virb4
QTM65_RS00515 (pVN4_00510) 79592..80299 - 708 WP_001259347 DsbC family protein -
QTM65_RS00520 (pVN4_00515) 80448..85979 - 5532 WP_000606833 Ig-like domain-containing protein -
QTM65_RS00525 (pVN4_00520) 86180..86572 - 393 WP_000479535 TraA family conjugative transfer protein -
QTM65_RS00530 (pVN4_00525) 86576..87154 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
QTM65_RS00535 (pVN4_00530) 87151..88464 - 1314 WP_024131605 TraB/VirB10 family protein traB
QTM65_RS00540 (pVN4_00535) 88464..89381 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
QTM65_RS00545 (pVN4_00540) 89365..89991 - 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
QTM65_RS00550 (pVN4_00545) 89988..90269 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
QTM65_RS00555 (pVN4_00550) 90414..90779 - 366 WP_001052531 hypothetical protein -
QTM65_RS00560 (pVN4_00555) 90791..90934 - 144 WP_001275801 hypothetical protein -
QTM65_RS00565 (pVN4_00560) 91115..91777 - 663 WP_001231463 hypothetical protein -
QTM65_RS00570 (pVN4_00565) 91777..92154 - 378 WP_000869261 hypothetical protein -
QTM65_RS00575 (pVN4_00570) 92164..92610 - 447 WP_000122506 hypothetical protein -
QTM65_RS00580 (pVN4_00575) 92620..93249 - 630 WP_000743450 DUF4400 domain-containing protein tfc7
QTM65_RS00585 (pVN4_00580) 93206..93790 - 585 WP_000332866 hypothetical protein -
QTM65_RS00590 (pVN4_00585) 93801..95666 - 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
QTM65_RS00595 (pVN4_00590) 95663..98641 - 2979 WP_001337757 MobH family relaxase -
QTM65_RS00600 (pVN4_00595) 98809..99426 + 618 WP_001249396 hypothetical protein -
QTM65_RS00605 (pVN4_00600) 99408..99641 + 234 WP_001191892 hypothetical protein -

Host bacterium

ID   13466 GenBank   NZ_OQ658822
Plasmid name   pST34VN4 Incompatibility group   IncA/C2
Plasmid size   175360 bp Coordinate of oriT [Strand]   93600..93750 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium strain 02_1206

Cargo genes

Drug resistance gene   floR, ere(D), mcr-3.1, aac(3)-IId, sul2, aph(3'')-Ib, aph(6)-Id, tet(A), erm(F), qnrS1, mph(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -