Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   111549
Name   oriT_pS304_2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium strain S304
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP061128 (13731..13783 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pS304_2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   8545 GenBank   WP_015059539
Name   t4cp2_IBY93_RS25600_pS304_2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32821..55651

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IBY93_RS25540 (IBY93_25525) 28043..29167 - 1125 WP_000486716 site-specific integrase -
IBY93_RS26215 (IBY93_25530) 30575..30796 + 222 Protein_34 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
IBY93_RS25550 (IBY93_25535) 30793..32169 - 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
IBY93_RS25555 (IBY93_25540) 32182..32817 - 636 WP_000934977 A24 family peptidase -
IBY93_RS25560 (IBY93_25545) 32821..33303 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
IBY93_RS25565 (IBY93_25550) 33369..33932 - 564 WP_034169414 type 4 pilus major pilin -
IBY93_RS25570 (IBY93_25555) 33982..35091 - 1110 WP_000974903 type II secretion system F family protein -
IBY93_RS25575 (IBY93_25560) 35082..36620 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
IBY93_RS25580 (IBY93_25565) 36645..37139 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
IBY93_RS25585 (IBY93_25570) 37123..38433 - 1311 WP_001454111 type 4b pilus protein PilO2 -
IBY93_RS25590 (IBY93_25575) 38484..40127 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
IBY93_RS25595 (IBY93_25580) 40120..40656 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
IBY93_RS25600 (IBY93_25585) 40703..42661 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
IBY93_RS25605 (IBY93_25590) 42677..43732 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
IBY93_RS25610 (IBY93_25595) 43751..44890 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
IBY93_RS25615 (IBY93_25600) 44880..45581 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein virB9
IBY93_RS25620 (IBY93_25605) 45647..46381 - 735 WP_000432282 type IV secretion system protein virB8
IBY93_RS25625 (IBY93_25610) 46381..46515 - 135 WP_000701233 hypothetical protein -
IBY93_RS25630 (IBY93_25615) 46547..48904 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
IBY93_RS25635 (IBY93_25620) 48910..49230 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
IBY93_RS26110 49301..49591 - 291 WP_000865479 conjugal transfer protein -
IBY93_RS25645 (IBY93_25630) 49591..50175 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
IBY93_RS25650 (IBY93_25635) 50196..50594 - 399 WP_001153669 hypothetical protein -
IBY93_RS25655 (IBY93_25640) 50713..51150 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
IBY93_RS25660 (IBY93_25645) 51156..52391 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
IBY93_RS25665 (IBY93_25650) 52394..52693 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
IBY93_RS25670 (IBY93_25655) 52741..53550 + 810 WP_024237698 DUF5710 domain-containing protein -
IBY93_RS25675 (IBY93_25660) 53773..53997 - 225 WP_000713562 EexN family lipoprotein -
IBY93_RS25680 (IBY93_25665) 54006..54650 - 645 WP_001310442 type IV secretion system protein -
IBY93_RS25685 (IBY93_25670) 54656..55651 - 996 WP_001028540 type IV secretion system protein virB6
IBY93_RS25690 (IBY93_25675) 55655..55912 - 258 WP_000739144 hypothetical protein -
IBY93_RS25695 (IBY93_25680) 55909..56211 - 303 WP_001360345 hypothetical protein -
IBY93_RS25700 (IBY93_25685) 56192..56449 - 258 WP_001542015 hypothetical protein -
IBY93_RS25705 (IBY93_25690) 56482..56928 - 447 WP_001243165 hypothetical protein -
IBY93_RS25710 (IBY93_25695) 56939..57109 - 171 WP_000550720 hypothetical protein -
IBY93_RS25715 (IBY93_25700) 57113..57556 - 444 WP_000964330 NfeD family protein -
IBY93_RS25720 (IBY93_25705) 57930..58883 - 954 WP_072089442 SPFH domain-containing protein -
IBY93_RS25725 (IBY93_25710) 58910..59086 - 177 WP_000753050 hypothetical protein -
IBY93_RS25730 (IBY93_25715) 59079..59294 - 216 WP_001127357 DUF1187 family protein -
IBY93_RS25735 (IBY93_25720) 59287..59739 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   11984 GenBank   NZ_CP061128
Plasmid name   pS304_2 Incompatibility group   IncI2
Plasmid size   60870 bp Coordinate of oriT [Strand]   13731..13783 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium strain S304

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -