Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   110996
Name   oriT_p1081-CTXM in_silico
Organism   Shigella sonnei strain #1081
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KJ460501 (17697..17749 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p1081-CTXM
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   8239 GenBank   WP_000338974
Name   t4cp2_BG81_RS00270_p1081-CTXM insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 33571..57116

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BG81_RS00205 (BG81_045) 28896..29549 - 654 WP_015387348 hypothetical protein -
BG81_RS00210 (BG81_046) 29561..30685 - 1125 WP_000486719 site-specific integrase -
BG81_RS00220 (BG81_048) 31633..32919 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BG81_RS00225 (BG81_049) 32932..33567 - 636 WP_000934978 A24 family peptidase -
BG81_RS00230 (BG81_050) 33571..33999 - 429 WP_001326801 lytic transglycosylase domain-containing protein virB1
BG81_RS00235 (BG81_051) 34120..34677 - 558 WP_000095051 type 4 pilus major pilin -
BG81_RS00240 (BG81_052) 34722..35831 - 1110 WP_000974900 type II secretion system F family protein -
BG81_RS00245 (BG81_053) 35822..37360 - 1539 WP_001420475 ATPase, T2SS/T4P/T4SS family virB11
BG81_RS00250 (BG81_054) 37385..37879 - 495 WP_000912551 type IV pilus biogenesis protein PilP -
BG81_RS00255 (BG81_055) 37863..39185 - 1323 WP_000454143 type 4b pilus protein PilO2 -
BG81_RS00260 (BG81_056) 39224..40867 - 1644 WP_001035590 PilN family type IVB pilus formation outer membrane protein -
BG81_RS00265 (BG81_057) 40860..41378 - 519 WP_015387353 YfdA protein virb4
BG81_RS00270 (BG81_058) 41425..43383 - 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
BG81_RS00275 (BG81_059) 43399..44454 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
BG81_RS00280 (BG81_060) 44473..45612 - 1140 WP_015387354 TrbI/VirB10 family protein virB10
BG81_RS00285 (BG81_061) 45602..46372 - 771 WP_015387355 TrbG/VirB9 family P-type conjugative transfer protein virB9
BG81_RS00290 (BG81_062) 46369..47103 - 735 WP_000432282 type IV secretion system protein virB8
BG81_RS00295 (BG81_063) 47267..49624 - 2358 WP_015387356 VirB4 family type IV secretion system protein virb4
BG81_RS00300 (BG81_064) 49630..49950 - 321 WP_000362081 VirB3 family type IV secretion system protein virB3
BG81_RS00440 (BG81_065) 50021..50311 - 291 WP_000865479 conjugal transfer protein -
BG81_RS00310 (BG81_066) 50311..50895 - 585 WP_001401693 lytic transglycosylase domain-containing protein virB1
BG81_RS00315 (BG81_067) 50916..51314 - 399 WP_001708012 hypothetical protein -
BG81_RS00320 (BG81_069) 51654..52091 - 438 WP_015387358 type IV pilus biogenesis protein PilM -
BG81_RS00325 (BG81_070) 52097..53332 - 1236 WP_001419735 TcpQ domain-containing protein -
BG81_RS00330 (BG81_071) 53335..53634 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
BG81_RS00335 (BG81_072) 53701..54333 - 633 WP_001419736 hypothetical protein -
BG81_RS00340 (BG81_073) 54381..55190 + 810 WP_001419737 DUF5710 domain-containing protein -
BG81_RS00345 (BG81_074) 55237..55473 - 237 WP_000750964 EexN family lipoprotein -
BG81_RS00350 (BG81_075) 55477..56124 - 648 WP_001419738 type IV secretion system protein -
BG81_RS00355 (BG81_076) 56130..57116 - 987 WP_001419739 type IV secretion system protein virB6
BG81_RS00360 (BG81_077) 57120..57377 - 258 WP_000739144 hypothetical protein -
BG81_RS00365 (BG81_078) 57374..57676 - 303 WP_001360345 hypothetical protein -
BG81_RS00370 (BG81_079) 57692..57943 - 252 WP_015387362 hypothetical protein -
BG81_RS00375 57940..58122 - 183 WP_022540746 hypothetical protein -
BG81_RS00380 (BG81_080) 58091..58753 - 663 WP_001419740 hypothetical protein -
BG81_RS00385 (BG81_081) 58764..58934 - 171 WP_000550721 hypothetical protein -
BG81_RS00390 (BG81_082) 58938..59381 - 444 WP_000964840 NfeD family protein -
BG81_RS00395 (BG81_083) 59454..60407 - 954 WP_072105959 SPFH domain-containing protein -
BG81_RS00400 (BG81_084) 60453..60647 - 195 WP_000049865 DUF1187 family protein -
BG81_RS00405 (BG81_085) 60640..61146 - 507 WP_001358485 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   11431 GenBank   NZ_KJ460501
Plasmid name   p1081-CTXM Incompatibility group   -
Plasmid size   62194 bp Coordinate of oriT [Strand]   17697..17749 [-]
Host baterium   Shigella sonnei strain #1081

Cargo genes


Drug resistance gene   blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -