Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 109997 |
| Name | oriT_p2017-45-174_1  |
| Organism | Serratia nevei strain 2017-45-174 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP109740 (76213..76262 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_p2017-45-174_1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 7289 | GenBank | WP_032744044 |
| Name | traD_OI978_RS27890_p2017-45-174_1 |
UniProt ID | _ |
| Length | 765 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 765 a.a. Molecular weight: 85286.01 Da Isoelectric Point: 5.1167
>WP_032744044.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLILMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVCAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKSRPKIAEGFILRNLDTRTDARLDTLLEAREAESSHARMLFTPDEATGMPEGGETATDTSGAPAEVAP
IKASPAAEKQPAQSVPVKAPSASQPVSPERHVTTVPLTVTRPAAATTGAAAAASTSGATAVPAGGTEQAL
EQQPAEQGQNMLPAGVNDAGEIEDMDAYDAWLATEQTQRDMQRREEVNINHSRSEHDDIEVGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLILMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVCAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKSRPKIAEGFILRNLDTRTDARLDTLLEAREAESSHARMLFTPDEATGMPEGGETATDTSGAPAEVAP
IKASPAAEKQPAQSVPVKAPSASQPVSPERHVTTVPLTVTRPAAATTGAAAAASTSGATAVPAGGTEQAL
EQQPAEQGQNMLPAGVNDAGEIEDMDAYDAWLATEQTQRDMQRREEVNINHSRSEHDDIEVGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 75660..104580
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI978_RS27685 (OI978_27695) | 70762..71490 | + | 729 | WP_004118966 | plasmid SOS inhibition protein A | - |
| OI978_RS27690 (OI978_27700) | 71487..71574 | + | 88 | Protein_89 | theronine dehydrogenase | - |
| OI978_RS27695 (OI978_27705) | 71894..72223 | + | 330 | WP_004118963 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OI978_RS27700 (OI978_27710) | 72204..72485 | + | 282 | WP_004118961 | helix-turn-helix transcriptional regulator | - |
| OI978_RS27705 (OI978_27715) | 73304..73579 | + | 276 | WP_032700867 | hypothetical protein | - |
| OI978_RS27710 (OI978_27720) | 73636..73794 | + | 159 | WP_162180130 | hypothetical protein | - |
| OI978_RS27715 (OI978_27725) | 73820..74167 | + | 348 | WP_032700835 | hypothetical protein | - |
| OI978_RS27720 (OI978_27730) | 74261..74407 | + | 147 | WP_032700834 | hypothetical protein | - |
| OI978_RS27725 (OI978_27735) | 75092..75622 | + | 531 | WP_032716647 | antirestriction protein | - |
| OI978_RS27730 (OI978_27740) | 75660..76139 | - | 480 | WP_032732069 | transglycosylase SLT domain-containing protein | virB1 |
| OI978_RS27735 (OI978_27745) | 76564..76950 | + | 387 | WP_032744117 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OI978_RS27740 (OI978_27750) | 77071..78051 | + | 981 | WP_000019473 | IS5-like element ISKpn26 family transposase | - |
| OI978_RS29120 | 78033..78215 | + | 183 | WP_348652683 | hypothetical protein | - |
| OI978_RS27745 (OI978_27755) | 78339..79013 | + | 675 | WP_077254474 | hypothetical protein | - |
| OI978_RS27750 (OI978_27760) | 79210..79365 | + | 156 | WP_071995759 | TraY domain-containing protein | - |
| OI978_RS27755 (OI978_27765) | 79439..79807 | + | 369 | WP_032744115 | type IV conjugative transfer system pilin TraA | - |
| OI978_RS27760 (OI978_27770) | 79821..80126 | + | 306 | WP_032744112 | type IV conjugative transfer system protein TraL | traL |
| OI978_RS27765 (OI978_27775) | 80145..80711 | + | 567 | WP_032744110 | type IV conjugative transfer system protein TraE | traE |
| OI978_RS27770 (OI978_27780) | 80698..81432 | + | 735 | WP_032744107 | type-F conjugative transfer system secretin TraK | traK |
| OI978_RS27775 (OI978_27785) | 81432..82856 | + | 1425 | WP_032744104 | F-type conjugal transfer pilus assembly protein TraB | traB |
| OI978_RS27780 (OI978_27790) | 82919..83488 | + | 570 | WP_071995755 | type IV conjugative transfer system lipoprotein TraV | traV |
| OI978_RS27785 (OI978_27795) | 84099..84350 | + | 252 | WP_048252518 | hypothetical protein | - |
| OI978_RS27790 (OI978_27800) | 84350..84754 | + | 405 | WP_032744097 | hypothetical protein | - |
| OI978_RS27795 (OI978_27805) | 84751..85095 | + | 345 | WP_032744094 | hypothetical protein | - |
| OI978_RS27800 (OI978_27810) | 85092..85490 | + | 399 | WP_227502459 | hypothetical protein | - |
| OI978_RS27805 (OI978_27815) | 85575..88214 | + | 2640 | WP_032744091 | type IV secretion system protein TraC | virb4 |
| OI978_RS27810 (OI978_27820) | 88214..88603 | + | 390 | WP_032744089 | type-F conjugative transfer system protein TrbI | - |
| OI978_RS27815 (OI978_27825) | 88600..89235 | + | 636 | WP_032744087 | type-F conjugative transfer system protein TraW | traW |
| OI978_RS27820 (OI978_27830) | 89270..89671 | + | 402 | WP_032744084 | hypothetical protein | - |
| OI978_RS27825 (OI978_27835) | 89668..90657 | + | 990 | WP_032744082 | conjugal transfer pilus assembly protein TraU | traU |
| OI978_RS27830 (OI978_27840) | 90670..91299 | + | 630 | WP_032744080 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| OI978_RS27835 (OI978_27845) | 91299..93254 | + | 1956 | WP_032744076 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| OI978_RS27840 (OI978_27850) | 93369..93980 | + | 612 | WP_032744074 | hypothetical protein | - |
| OI978_RS27845 (OI978_27855) | 93970..94197 | + | 228 | WP_032744071 | conjugal transfer protein TrbE | - |
| OI978_RS27850 (OI978_27860) | 94207..94533 | + | 327 | WP_032744069 | hypothetical protein | - |
| OI978_RS27855 (OI978_27865) | 94556..95308 | + | 753 | WP_032744065 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| OI978_RS27860 (OI978_27870) | 95319..95555 | + | 237 | WP_032744062 | type-F conjugative transfer system pilin chaperone TraQ | - |
| OI978_RS27865 (OI978_27875) | 95530..96096 | + | 567 | WP_032744059 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| OI978_RS27870 (OI978_27880) | 96089..96517 | + | 429 | WP_032744057 | conjugal transfer protein TrbF | - |
| OI978_RS27875 (OI978_27885) | 96504..97874 | + | 1371 | WP_032744054 | conjugal transfer pilus assembly protein TraH | traH |
| OI978_RS27880 (OI978_27890) | 97874..100723 | + | 2850 | WP_032744052 | conjugal transfer mating-pair stabilization protein TraG | traG |
| OI978_RS29125 | 100729..101255 | + | 527 | Protein_129 | conjugal transfer protein TraS | - |
| OI978_RS27885 (OI978_27895) | 101357..102088 | + | 732 | WP_032744047 | conjugal transfer complement resistance protein TraT | - |
| OI978_RS27890 (OI978_27900) | 102283..104580 | + | 2298 | WP_032744044 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 10432 | GenBank | NZ_CP109740 |
| Plasmid name | p2017-45-174_1 | Incompatibility group | IncFIA |
| Plasmid size | 133721 bp | Coordinate of oriT [Strand] | 76213..76262 [-] |
| Host baterium | Serratia nevei strain 2017-45-174 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | arsR, arsD, arsA, arsB, arsH, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silF, silC, silR, silS, silE, merR, merT, merP, merA, merD, merE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |