Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   109798
Name   oriT_C. koseri 0|P1 in_silico
Organism   Citrobacter koseri isolate 0
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OW969692 (26794..26866 [-], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_C. koseri 0|P1
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   6483 GenBank   WP_000991384
Name   Relaxase_LQV22_RS22315_C. koseri 0|P1 insolico UniProt ID   A0A8H8Z9E5
Length   903 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 903 a.a.        Molecular weight: 104595.99 Da        Isoelectric Point: 7.6377

>WP_000991384.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRIRMGTGPQGAIKRELFSDKESLWGY
TTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVELGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEARLQKDGS
VRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPRMGFEPEGSYQQFNDVFAEMVAW
HNAAGITGSGHFVISRPDVDLHRQRSEQYYHEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure



No available structure.




Auxiliary protein

ID   3421 GenBank   WP_001291058
Name   WP_001291058_C. koseri 0|P1 insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   7106 GenBank   WP_000077663
Name   trbC_LQV22_RS22400_C. koseri 0|P1 insolico UniProt ID   _
Length   767 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 767 a.a.        Molecular weight: 87012.13 Da        Isoelectric Point: 7.3008

>WP_000077663.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETFPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMLLARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMTAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRQLATAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 48911..92906

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV22_RS22385 43977..44084 - 108 Protein_52 aminoglycoside phosphotransferase family protein -
LQV22_RS22390 44084..44887 - 804 WP_001082319 aminoglycoside O-phosphotransferase APH(3'')-Ib -
LQV22_RS22395 (AN2351V1_4340) 44948..45763 - 816 WP_001043260 sulfonamide-resistant dihydropteroate synthase Sul2 -
LQV22_RS22400 (AN2351V1_4342) 46627..48930 - 2304 WP_000077663 F-type conjugative transfer protein TrbC -
LQV22_RS22405 (AN2351V1_4343) 48911..50035 - 1125 WP_001557490 DsbC family protein trbB
LQV22_RS22410 (AN2351V1_4344) 50032..51321 - 1290 WP_000121916 IncI1-type conjugal transfer protein TrbA trbA
LQV22_RS22415 51659..51805 + 147 WP_001346191 hypothetical protein -
LQV22_RS23145 (AN2351V1_4345) 51858..51953 + 96 WP_001388983 DinQ-like type I toxin DqlB -
LQV22_RS23150 (AN2351V1_4346) 52542..52637 + 96 WP_001388983 DinQ-like type I toxin DqlB -
LQV22_RS22425 (AN2351V1_4347) 52700..52876 - 177 WP_001054907 hypothetical protein -
LQV22_RS22430 (AN2351V1_4348) 53026..53493 - 468 WP_000598962 thermonuclease family protein -
LQV22_RS22435 (AN2351V1_4349) 53653..54276 + 624 WP_001155250 helix-turn-helix domain-containing protein -
LQV22_RS22440 (AN2351V1_4351) 54474..54689 - 216 WP_000266543 hypothetical protein -
LQV22_RS22445 (AN2351V1_4352) 54693..55061 - 369 WP_001345852 hypothetical protein -
LQV22_RS22450 (AN2351V1_4353) 55352..55594 - 243 WP_000650923 hypothetical protein -
LQV22_RS22455 (AN2351V1_4354) 55924..56076 + 153 WP_001335079 Hok/Gef family protein -
LQV22_RS22460 (AN2351V1_4355) 56214..57800 - 1587 WP_000004564 TnsA endonuclease N-terminal domain-containing protein -
LQV22_RS22465 (AN2351V1_4356) 58074..58721 - 648 WP_015056434 plasmid IncI1-type surface exclusion protein ExcA -
LQV22_RS22470 (AN2351V1_4357) 58809..60968 - 2160 WP_000691811 DotA/TraY family protein traY
LQV22_RS22475 (AN2351V1_4358) 61043..61612 - 570 WP_000650752 conjugal transfer protein TraX -
LQV22_RS22480 (AN2351V1_4359) 61609..62814 - 1206 WP_001189548 conjugal transfer protein TraW traW
LQV22_RS22485 (AN2351V1_4360) 62772..63392 - 621 WP_000286855 hypothetical protein traV
LQV22_RS22490 (AN2351V1_4361) 63392..66436 - 3045 WP_001024769 conjugal transfer protein traU
LQV22_RS22495 (AN2351V1_4362) 66572..66760 - 189 Protein_75 IS66 family transposase -
LQV22_RS22500 (AN2351V1_4363) 66821..67954 + 1134 WP_000555378 IS110-like element ISEc45 family transposase -
LQV22_RS22505 (AN2351V1_4364) 68207..69631 - 1425 Protein_77 IS66-like element ISEc23 family transposase -
LQV22_RS22510 (AN2351V1_4365) 69662..70012 - 351 WP_000624722 IS66 family insertion sequence element accessory protein TnpB -
LQV22_RS22515 (AN2351V1_4366) 70009..70434 - 426 WP_000422741 transposase -
LQV22_RS22520 (AN2351V1_4367) 70717..71343 - 627 WP_000785703 hypothetical protein traT
LQV22_RS23155 (AN2351V1_4368) 71450..71701 - 252 WP_001277573 hypothetical protein -
LQV22_RS22530 (AN2351V1_4369) 71758..72156 - 399 WP_000088813 DUF6750 family protein traR
LQV22_RS22535 (AN2351V1_4370) 72203..72733 - 531 WP_000987021 conjugal transfer protein TraQ traQ
LQV22_RS22540 (AN2351V1_4371) 72730..73443 - 714 WP_000787002 conjugal transfer protein TraP traP
LQV22_RS22545 (AN2351V1_4372) 73440..74777 - 1338 WP_001557492 conjugal transfer protein TraO traO
LQV22_RS22550 (AN2351V1_4373) 74781..75755 - 975 WP_000547386 DotH/IcmK family type IV secretion protein traN
LQV22_RS22555 (AN2351V1_4374) 75766..76461 - 696 WP_001287545 DotI/IcmL family type IV secretion protein traM
LQV22_RS22560 (AN2351V1_4375) 76473..76823 - 351 WP_068862892 conjugal transfer protein traL
LQV22_RS22565 (AN2351V1_4376) 76840..80901 - 4062 WP_000842456 LPD7 domain-containing protein -
LQV22_RS22570 (AN2351V1_4377) 80965..81255 - 291 WP_000817801 IcmT/TraK family protein traK
LQV22_RS22575 (AN2351V1_4378) 81252..82400 - 1149 WP_000775210 plasmid transfer ATPase TraJ virB11
LQV22_RS22580 (AN2351V1_4379) 82384..83220 - 837 WP_000745049 type IV secretory system conjugative DNA transfer family protein traI
LQV22_RS22585 (AN2351V1_4380) 83217..83675 - 459 WP_001170111 DotD/TraH family lipoprotein -
LQV22_RS22590 (AN2351V1_4381) 83779..84981 - 1203 WP_000979993 conjugal transfer protein TraF -
LQV22_RS22595 (AN2351V1_4382) 85083..85904 - 822 WP_000845373 hypothetical protein traE
LQV22_RS22600 86069..86263 - 195 Protein_96 integrase -
LQV22_RS22605 (AN2351V1_REPA000000007) 86382..87079 + 698 WP_095033700 IS1-like element IS1B family transposase -
LQV22_RS22610 (AN2351V1_4386) 87153..88514 - 1362 WP_001168171 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LQV22_RS22615 (AN2351V1_4387) 88532..89158 - 627 WP_000939245 prepilin peptidase -
LQV22_RS22620 (AN2351V1_4388) 89174..89659 - 486 WP_001080767 lytic transglycosylase domain-containing protein virB1
LQV22_RS22625 (AN2351V1_4389) 89704..90240 - 537 WP_000111534 type 4 pilus major pilin -
LQV22_RS22630 (AN2351V1_4390) 90302..91396 - 1095 WP_000697158 type II secretion system F family protein -
LQV22_RS22635 (AN2351V1_4391) 91398..92906 - 1509 WP_000880805 ATPase, T2SS/T4P/T4SS family virB11
LQV22_RS22640 (AN2351V1_4392) 93010..93468 - 459 WP_000095885 type IV pilus biogenesis protein PilP -
LQV22_RS22645 (AN2351V1_4393) 93458..94753 - 1296 WP_000129882 type 4b pilus protein PilO2 -
LQV22_RS22650 (AN2351V1_4394) 94774..96393 - 1620 WP_001035565 PilN family type IVB pilus formation outer membrane protein -
LQV22_RS22655 (AN2351V1_4395) 96425..96862 - 438 WP_000539952 type IV pilus biogenesis protein PilM -

Host bacterium

ID   10233 GenBank   NZ_OW969692
Plasmid name   C. koseri 0|P1 Incompatibility group   IncB/O/K/Z
Plasmid size   103689 bp Coordinate of oriT [Strand]   26794..26866 [-]
Host baterium   Citrobacter koseri isolate 0

Cargo genes

Drug resistance gene   floR, aph(6)-Id, blaTEM-1C, aph(3'')-Ib, sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -