Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 108770
• Name: oriT_p2NCPPB4222
• Organism: Pseudomonas avellanae strain NCPPB 4222
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP091149 (19517..19698 [-], 182 nt)
• oriT length: 182 nt
• IRs (inverted repeats): 82..89, 93..100 (CAAAGGGG..CCCCTTTG) 44..49, 58..63 (AAAAAG..CTTTTT)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 182 nt

>oriT_p2NCPPB4222
AAATCTCGAATTCGCTAAACAGGCACGTTACCGATTGTCTACAAAAAAGAGCTTCGCCTTTTTCGTAGCCAATCGACGTGCCAAAGGGGATACCCCTTTGAAACCCCGCAGAGCGGGAAAGCGTTGTCGCTGTCGTTGTTGGTTGTCGTCATCCAGGTTCCCTCAGGAGGTGATCTTGTGGC

oriT secondary structure

Predicted by RNAfold.

Relaxase

MobA_MobL_L2Y01_RS28390_p2NCPPB4222

• ID: 5880
• GenBank: WP_024420044
• Name: MobA_MobL_L2Y01_RS28390_p2NCPPB4222
• UniProt ID: A0A0Q0A236
• Length: 144 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 144 a.a.
• Molecular weight: 16104.35 Da
• Isoelectric Point: 10.4378

>WP_024420044.1 MULTISPECIES: MobA/MobL family protein [Pseudomonas syringae group]
MTHPEIRFLNLRIRGRSQAKTEAEIIAIFHASTKPIARSAGRSYVAAAYRSGTKLVDIRTSLVHDYTRRG
GVFSTEIMFPDGTSTERNALWNAAESAEKRKDGRTGREWIIALPAELDDGARQKLASAFGIELANLLPFQ
MIWQ

Protein domains

Predicted by InterproScan.

• MobA/MobL family (MobA_MobL) (45-129)

Protein structure

• AlphaFold DB: A0A0Q0A236

Host bacterium

• ID: 9205
• GenBank: NZ_CP091149
• Plasmid name: p2NCPPB4222
• Incompatibility group: -
• Plasmid size: 50625 bp
• Coordinate of oriT [Strand]: 19517..19698 [-]
• Host baterium: Pseudomonas avellanae strain NCPPB 4222

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -