Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   108759
Name   oriT_p14523A in_silico
Organism   Salmonella sp. SJTUF14523
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP074429 (85417..85505 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p14523A
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   2898 GenBank   WP_001283947
Name   WP_001283947_p14523A insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP


ID   6309 GenBank   WP_012783931
Name   trbC_KFD69_RS22650_p14523A insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86911.02 Da        Isoelectric Point: 6.7713

>WP_012783931.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILTAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 5021..43923

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFD69_RS22650 (KFD69_22635) 2737..5028 - 2292 WP_012783931 F-type conjugative transfer protein TrbC -
KFD69_RS22655 (KFD69_22640) 5021..6091 - 1071 WP_012783932 IncI1-type conjugal transfer protein TrbB trbB
KFD69_RS22660 (KFD69_22645) 6110..7318 - 1209 WP_001703845 IncI1-type conjugal transfer protein TrbA trbA
KFD69_RS22665 (KFD69_22650) 7625..8404 - 780 WP_275450201 protein FinQ -
KFD69_RS22670 (KFD69_22655) 9031..9183 + 153 WP_001387489 Hok/Gef family protein -
KFD69_RS22675 (KFD69_22660) 9255..9506 - 252 WP_001291964 hypothetical protein -
KFD69_RS24035 10007..10102 + 96 WP_000609148 DinQ-like type I toxin DqlB -
KFD69_RS22685 (KFD69_22670) 10167..10343 - 177 WP_001054900 hypothetical protein -
KFD69_RS22690 (KFD69_22675) 10735..10944 + 210 WP_000062603 HEAT repeat domain-containing protein -
KFD69_RS22695 (KFD69_22680) 11016..11678 - 663 WP_012783935 plasmid IncI1-type surface exclusion protein ExcA -
KFD69_RS22700 (KFD69_22685) 11749..13917 - 2169 WP_015508354 DotA/TraY family protein traY
KFD69_RS22705 (KFD69_22690) 14014..14598 - 585 WP_012783937 conjugal transfer protein TraX -
KFD69_RS22710 (KFD69_22695) 14627..15829 - 1203 WP_012783938 IncI1-type conjugal transfer protein TraW traW
KFD69_RS22715 (KFD69_22700) 15796..16410 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
KFD69_RS22720 (KFD69_22705) 16410..19454 - 3045 WP_012783939 IncI1-type conjugal transfer protein TraU traU
KFD69_RS22725 (KFD69_22710) 19544..20344 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
KFD69_RS22730 (KFD69_22715) 20328..20516 - 189 WP_001277255 putative conjugal transfer protein TraS -
KFD69_RS22735 (KFD69_22720) 20580..20984 - 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
KFD69_RS22740 (KFD69_22725) 21035..21562 - 528 WP_001055569 conjugal transfer protein TraQ traQ
KFD69_RS22745 (KFD69_22730) 21562..22266 - 705 WP_001493811 IncI1-type conjugal transfer protein TraP traP
KFD69_RS22750 (KFD69_22735) 22266..23555 - 1290 WP_011264042 conjugal transfer protein TraO traO
KFD69_RS22755 (KFD69_22740) 23558..24541 - 984 WP_001191880 IncI1-type conjugal transfer protein TraN traN
KFD69_RS22760 (KFD69_22745) 24552..25244 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
KFD69_RS22765 (KFD69_22750) 25241..25588 - 348 WP_001055900 conjugal transfer protein traL
KFD69_RS22770 (KFD69_22755) 25606..29373 - 3768 WP_012783940 LPD7 domain-containing protein -
KFD69_RS22775 (KFD69_22760) 29463..30014 - 552 WP_012783942 phospholipase D family protein -
KFD69_RS22780 (KFD69_22765) 30029..30319 - 291 WP_001314267 hypothetical protein traK
KFD69_RS22785 (KFD69_22770) 30316..31464 - 1149 WP_001024971 plasmid transfer ATPase TraJ virB11
KFD69_RS22790 (KFD69_22775) 31461..32279 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
KFD69_RS22795 (KFD69_22780) 32276..32734 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
KFD69_RS22800 (KFD69_22785) 33128..33712 - 585 WP_000977522 histidine phosphatase family protein -
KFD69_RS22805 (KFD69_22790) 33772..34974 - 1203 WP_000976353 conjugal transfer protein TraF -
KFD69_RS22810 (KFD69_22795) 35060..35884 - 825 WP_001238932 conjugal transfer protein TraE traE
KFD69_RS22815 (KFD69_22800) 36035..37189 - 1155 WP_001139955 site-specific integrase -
KFD69_RS22820 (KFD69_22805) 37188..37463 + 276 WP_000958118 hypothetical protein -
KFD69_RS22825 (KFD69_22810) 37460..37708 - 249 WP_001349157 hypothetical protein -
KFD69_RS22830 (KFD69_22815) 38089..39417 - 1329 WP_001496394 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
KFD69_RS22835 (KFD69_22820) 39417..40073 - 657 WP_213630803 prepilin peptidase -
KFD69_RS22840 (KFD69_22825) 40058..40618 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
KFD69_RS22845 (KFD69_22830) 40628..41242 - 615 WP_001542527 type 4 pilus major pilin -
KFD69_RS22850 (KFD69_22835) 41260..42357 - 1098 WP_001492931 type II secretion system F family protein -
KFD69_RS22855 (KFD69_22840) 42370..43923 - 1554 WP_001492932 ATPase, T2SS/T4P/T4SS family virB11
KFD69_RS22860 (KFD69_22845) 43934..44386 - 453 WP_012783945 type IV pilus biogenesis protein PilP -
KFD69_RS22865 (KFD69_22850) 44373..45668 - 1296 WP_012783946 type 4b pilus protein PilO2 -
KFD69_RS22870 (KFD69_22855) 45661..47343 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
KFD69_RS22875 (KFD69_22860) 47357..47794 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
KFD69_RS22880 (KFD69_22865) 47794..48861 - 1068 WP_012783947 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   9194 GenBank   NZ_CP074429
Plasmid name   p14523A Incompatibility group   IncI1
Plasmid size   85862 bp Coordinate of oriT [Strand]   85417..85505 [-]
Host baterium   Salmonella sp. SJTUF14523

Cargo genes


Drug resistance gene   blaCTX-M-101
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2