Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 108758 |
Name | oriT_pVTX9_1 |
Organism | Bacillus velezensis strain VTX9 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP074686 (13762..13785 [-], 24 nt) |
oriT length | 24 nt |
IRs (inverted repeats) | 1..7, 18..24 (ACCCCCC..GGGGGGT) 3..8, 18..23 (CCCCCC..GGGGGG) |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 24 nt
>oriT_pVTX9_1
ACCCCCCCACGCTAACAGGGGGGT
ACCCCCCCACGCTAACAGGGGGGT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 6308 | GenBank | WP_213404079 |
Name | tcpA_KH263_RS19505_pVTX9_1 | UniProt ID | _ |
Length | 480 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 480 a.a. Molecular weight: 54871.27 Da Isoelectric Point: 9.6383
>WP_213404079.1 ATP-binding protein [Bacillus velezensis]
MINFLQNRVWKYRGKRIRPYMRNNLKLAGAIIFVPVFLLSMFIFWKDQLLHLDVMKTVKHFEWNVPLIIK
SVLFSLLAVAACAVLAYFLFYDGYKKLYHRQKIARMIFSNKFYEKESVQVKKLFSNDTATKEKITYFPRM
YYQVKDNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLVDKEMEEGFVCFKLLYDVKKNRISIDDAVAK
DGVLPLMKHVSWKFDKLPHMLISGGTGGGKTYFMLTIIKACVGLGADVKILDPKNADLADLEEVLPKRVY
SQKNGILMCLRKSVDGMMERMDEMKKMPNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNDALSYM
KQLVMLGRQAGYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVDKAFVNKKVTGRGYA
NVGTGSVLEFYSPIVPKGYDFMSSIKESLVGVTGAQATAVASGSVSDQTASGERRSEASE
MINFLQNRVWKYRGKRIRPYMRNNLKLAGAIIFVPVFLLSMFIFWKDQLLHLDVMKTVKHFEWNVPLIIK
SVLFSLLAVAACAVLAYFLFYDGYKKLYHRQKIARMIFSNKFYEKESVQVKKLFSNDTATKEKITYFPRM
YYQVKDNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLVDKEMEEGFVCFKLLYDVKKNRISIDDAVAK
DGVLPLMKHVSWKFDKLPHMLISGGTGGGKTYFMLTIIKACVGLGADVKILDPKNADLADLEEVLPKRVY
SQKNGILMCLRKSVDGMMERMDEMKKMPNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNDALSYM
KQLVMLGRQAGYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVDKAFVNKKVTGRGYA
NVGTGSVLEFYSPIVPKGYDFMSSIKESLVGVTGAQATAVASGSVSDQTASGERRSEASE
Protein domains
No domain identified.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 2701..15653
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KH263_RS19415 (KH263_19415) | 1..20007 | - | 20007 | WP_045206624 | Rap family tetratricopeptide repeat protein | - |
KH263_RS19420 (KH263_19420) | 795..1625 | - | 831 | WP_213404086 | hypothetical protein | - |
KH263_RS19425 (KH263_19425) | 1733..2113 | - | 381 | WP_045206627 | cystatin-like fold lipoprotein | - |
KH263_RS19430 (KH263_19430) | 2176..2517 | - | 342 | Protein_3 | hypothetical protein | - |
KH263_RS19435 (KH263_19435) | 2701..3711 | - | 1011 | WP_060560228 | bifunctional lytic transglycosylase/C40 family peptidase | orf14 |
KH263_RS19440 (KH263_19440) | 3708..6074 | - | 2367 | WP_213404088 | hypothetical protein | orf15 |
KH263_RS19445 (KH263_19445) | 6085..6411 | - | 327 | WP_017418466 | YddF family protein | - |
KH263_RS19450 (KH263_19450) | 6425..8920 | - | 2496 | WP_213404090 | ATP-binding protein | virb4 |
KH263_RS19455 (KH263_19455) | 8808..9332 | - | 525 | WP_213404092 | conjugal transfer protein | orf17b |
KH263_RS19460 (KH263_19460) | 9344..9592 | - | 249 | WP_172869049 | hypothetical protein | - |
KH263_RS19465 (KH263_19465) | 9608..10672 | - | 1065 | WP_213404094 | conjugal transfer protein | orf13 |
KH263_RS19470 (KH263_19470) | 10685..10978 | - | 294 | WP_213404071 | hypothetical protein | - |
KH263_RS19475 (KH263_19475) | 10995..11309 | - | 315 | WP_213404073 | hypothetical protein | - |
KH263_RS19480 (KH263_19480) | 11320..11607 | - | 288 | WP_039062656 | hypothetical protein | - |
KH263_RS19485 (KH263_19485) | 11629..11883 | - | 255 | WP_045206647 | DUF3850 domain-containing protein | - |
KH263_RS19490 (KH263_19490) | 11905..12177 | - | 273 | WP_249719490 | hypothetical protein | - |
KH263_RS19495 (KH263_19495) | 12191..12466 | - | 276 | WP_213404075 | hypothetical protein | - |
KH263_RS19500 (KH263_19500) | 12744..13802 | - | 1059 | WP_213404077 | replication initiation factor domain-containing protein | - |
KH263_RS19505 (KH263_19505) | 13795..15237 | - | 1443 | WP_213404079 | ATP-binding protein | virb4 |
KH263_RS19510 (KH263_19510) | 15273..15653 | - | 381 | WP_045206656 | YdcP family protein | orf23 |
KH263_RS19515 (KH263_19515) | 16014..16274 | - | 261 | WP_045927024 | hypothetical protein | - |
KH263_RS19520 (KH263_19520) | 16325..16585 | - | 261 | WP_213404081 | hypothetical protein | - |
KH263_RS19525 (KH263_19525) | 16582..16773 | - | 192 | WP_045206659 | hypothetical protein | - |
KH263_RS19530 (KH263_19530) | 16950..17327 | + | 378 | WP_045206661 | helix-turn-helix transcriptional regulator | - |
KH263_RS19535 (KH263_19535) | 17324..17845 | + | 522 | WP_213404084 | ImmA/IrrE family metallo-endopeptidase | - |
KH263_RS19540 (KH263_19540) | 17866..19008 | + | 1143 | WP_045206663 | site-specific integrase | - |
Host bacterium
ID | 9193 | GenBank | NZ_CP074686 |
Plasmid name | pVTX9_1 | Incompatibility group | - |
Plasmid size | 20007 bp | Coordinate of oriT [Strand] | 13762..13785 [-] |
Host baterium | Bacillus velezensis strain VTX9 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |