Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   108758
Name   oriT_pVTX9_1 in_silico
Organism   Bacillus velezensis strain VTX9
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP074686 (13762..13785 [-], 24 nt)
oriT length   24 nt
IRs (inverted repeats)      1..7, 18..24  (ACCCCCC..GGGGGGT)
 3..8, 18..23  (CCCCCC..GGGGGG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 24 nt

>oriT_pVTX9_1
ACCCCCCCACGCTAACAGGGGGGT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   6308 GenBank   WP_213404079
Name   tcpA_KH263_RS19505_pVTX9_1 insolico UniProt ID   _
Length   480 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 480 a.a.        Molecular weight: 54871.27 Da        Isoelectric Point: 9.6383

>WP_213404079.1 ATP-binding protein [Bacillus velezensis]
MINFLQNRVWKYRGKRIRPYMRNNLKLAGAIIFVPVFLLSMFIFWKDQLLHLDVMKTVKHFEWNVPLIIK
SVLFSLLAVAACAVLAYFLFYDGYKKLYHRQKIARMIFSNKFYEKESVQVKKLFSNDTATKEKITYFPRM
YYQVKDNHIYIRIAMDMSRFQNRFLDLGKDLENGLFCDLVDKEMEEGFVCFKLLYDVKKNRISIDDAVAK
DGVLPLMKHVSWKFDKLPHMLISGGTGGGKTYFMLTIIKACVGLGADVKILDPKNADLADLEEVLPKRVY
SQKNGILMCLRKSVDGMMERMDEMKKMPNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDMKERNDALSYM
KQLVMLGRQAGYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYGMMFGDVDKAFVNKKVTGRGYA
NVGTGSVLEFYSPIVPKGYDFMSSIKESLVGVTGAQATAVASGSVSDQTASGERRSEASE

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2701..15653

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KH263_RS19415 (KH263_19415) 1..20007 - 20007 WP_045206624 Rap family tetratricopeptide repeat protein -
KH263_RS19420 (KH263_19420) 795..1625 - 831 WP_213404086 hypothetical protein -
KH263_RS19425 (KH263_19425) 1733..2113 - 381 WP_045206627 cystatin-like fold lipoprotein -
KH263_RS19430 (KH263_19430) 2176..2517 - 342 Protein_3 hypothetical protein -
KH263_RS19435 (KH263_19435) 2701..3711 - 1011 WP_060560228 bifunctional lytic transglycosylase/C40 family peptidase orf14
KH263_RS19440 (KH263_19440) 3708..6074 - 2367 WP_213404088 hypothetical protein orf15
KH263_RS19445 (KH263_19445) 6085..6411 - 327 WP_017418466 YddF family protein -
KH263_RS19450 (KH263_19450) 6425..8920 - 2496 WP_213404090 ATP-binding protein virb4
KH263_RS19455 (KH263_19455) 8808..9332 - 525 WP_213404092 conjugal transfer protein orf17b
KH263_RS19460 (KH263_19460) 9344..9592 - 249 WP_172869049 hypothetical protein -
KH263_RS19465 (KH263_19465) 9608..10672 - 1065 WP_213404094 conjugal transfer protein orf13
KH263_RS19470 (KH263_19470) 10685..10978 - 294 WP_213404071 hypothetical protein -
KH263_RS19475 (KH263_19475) 10995..11309 - 315 WP_213404073 hypothetical protein -
KH263_RS19480 (KH263_19480) 11320..11607 - 288 WP_039062656 hypothetical protein -
KH263_RS19485 (KH263_19485) 11629..11883 - 255 WP_045206647 DUF3850 domain-containing protein -
KH263_RS19490 (KH263_19490) 11905..12177 - 273 WP_249719490 hypothetical protein -
KH263_RS19495 (KH263_19495) 12191..12466 - 276 WP_213404075 hypothetical protein -
KH263_RS19500 (KH263_19500) 12744..13802 - 1059 WP_213404077 replication initiation factor domain-containing protein -
KH263_RS19505 (KH263_19505) 13795..15237 - 1443 WP_213404079 ATP-binding protein virb4
KH263_RS19510 (KH263_19510) 15273..15653 - 381 WP_045206656 YdcP family protein orf23
KH263_RS19515 (KH263_19515) 16014..16274 - 261 WP_045927024 hypothetical protein -
KH263_RS19520 (KH263_19520) 16325..16585 - 261 WP_213404081 hypothetical protein -
KH263_RS19525 (KH263_19525) 16582..16773 - 192 WP_045206659 hypothetical protein -
KH263_RS19530 (KH263_19530) 16950..17327 + 378 WP_045206661 helix-turn-helix transcriptional regulator -
KH263_RS19535 (KH263_19535) 17324..17845 + 522 WP_213404084 ImmA/IrrE family metallo-endopeptidase -
KH263_RS19540 (KH263_19540) 17866..19008 + 1143 WP_045206663 site-specific integrase -


Host bacterium


ID   9193 GenBank   NZ_CP074686
Plasmid name   pVTX9_1 Incompatibility group   -
Plasmid size   20007 bp Coordinate of oriT [Strand]   13762..13785 [-]
Host baterium   Bacillus velezensis strain VTX9

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -