Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   108648
Name   oriT_MIP2461_p1 in_silico
Organism   Hafnia paralvei strain MIP2461 isolate MIP2461
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OX460964 (73003..73088 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_MIP2461_p1
TAAGGGACAAGATGTGTTTTGTAGCACCGCCTGCACGCAGTCGGCCCCTACAAAACGTCTTGGTCAGGGCGAAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5770 GenBank   WP_115349503
Name   Relaxase_QOT00_RS22535_MIP2461_p1 insolico UniProt ID   _
Length   664 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 664 a.a.        Molecular weight: 76731.32 Da        Isoelectric Point: 6.3983

>WP_115349503.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Hafnia]
MIGRIPPKRRDGKSSFLKLVSYVVIRDEDKPDMPLEPEHPDWRRPKSTDDLFNRLVDYVSRSGDEGAMHT
LNIDDDGRQRVLFDGVLCETNNFSLATAAVEMNAVALQNTRCKDPVFHYILSWPTSDNPNQDEVFDSVRH
TLKSFGMDEHQYVAAIHTDTNNIHCHIAVNRVHPVTYDTADDSFTCLKLQRACRELELKYDWTPTNGCYV
VDENKQIVYKKRDEPPVPQGSVAMEYYADQESLHSYAMRTCSDDLEKLIVKDELTWFELHKLLVKQGLRL
DKKGKGLAIYSLDEKDITPIKASHLHPDLTLNCLEDDLGPFEKLEDAGRYTLDTNDEGDDALIHMYRYEP
HLHKRDEDARAARREARAIARRELFDRYKKYSSGYKRPKMEGTEATSQFKALSNRYAWKKEQVRFVFDDP
LIRKAVYRVLEAERQKEFESLKAQIKQERNAFYSHPSNRKLTKQEWVGQQALKQDQAAISCLRGWSYRYK
RDALTPPLSENAIVCAVADDTKPYNIQGYEKSVSRDGTIQYKQDGIIQIQDKGSRLEIADPYAQNGLHIA
GAMVLAVEKSGEKMLFSGDTEFVESACDLVPWFNQEGKKILPLTEPQQRVMAGYDKAEVRDDAFVATHRI
VDEETYLASLERNEVNDNRERHDLKHKKNTYRPR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(52-319)


  Protein structure



No available structure.




T4CP

ID   6182 GenBank   WP_115349501
Name   trbC_QOT00_RS22400_MIP2461_p1 insolico UniProt ID   _
Length   731 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 731 a.a.        Molecular weight: 83025.67 Da        Isoelectric Point: 7.4973

>WP_115349501.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Hafnia]
MPSDNTQPVDKVRVRQTTQSTWIDDYLLAPVTVQAGLVVILILTFLRTWVLIPGVFATAIWLLTFFGQLF
RMPLRMPKDIGGLDMTTERENAYEFKGPMGLFRFTRRRLSWDKSAGIMCLGHARRRFLGRELWLTRDDCL
RHMQLLATTGSGKTEALLSIQLNSICMGRGMTFSDGKAETNLAYAIWSLMRRYGQEDNYYVLNFLNGGRD
RFDELLGNDRTRPQSNSINFFGDATATFIIQLMESLLPQVGASEAGWQDKAKPMLYGLVYALYYKCKKES
LRLSQSMIQKHLPLKKMAELYIEGKQNGWHDEALNALESYLNNLAGFRMELVSKPSEWDQGVYDQHGFLI
QQFSRMLAMFNDVYGHIFATDAGDIDIRDVLHNDRTLVVLIPALELSKSESANLGKLYISAKRMVIARDL
GYQLEGKRKDVLIAKKFVNPFPYPDIHDELGSYFAPGMDDLAAQMRSLGMMLVISAQDIQRFIAQFKGEY
QTVNANMLVKWFMALQDEKDTFELAKATAGKDYYAELGEMKRTPGTVSSSYEEANTTYIREKNRISLDEL
KDLNPGEGFISFKSALVPSSAIYIPDDEKLSSKLELRINRFIDIGSPTEADLIAQNPHLSRLLPPSEMEV
SMVLQRTDEIVAGSETHTIPPLMDPILARLMKVAMDLDNRCDISYSPTQRGILLFEAARDVLNKRGKKWF
TVKTQPNPLKVSDAMARRLAKQSTAFMSQDH

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(448-563)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 10658..39701

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOT00_RS22235 6615..7046 + 432 WP_115349490 type IV pilus biogenesis protein PilM -
QOT00_RS22240 7061..8686 + 1626 WP_115349491 PilN family type IVB pilus formation outer membrane protein -
QOT00_RS22245 8691..9971 + 1281 WP_115349492 type 4b pilus protein PilO2 -
QOT00_RS22250 9958..10473 + 516 WP_064575626 type IV pilus biogenesis protein PilP -
QOT00_RS22255 10476..10661 + 186 WP_115349493 hypothetical protein -
QOT00_RS22260 10658..12157 + 1500 WP_115349494 ATPase, T2SS/T4P/T4SS family virB11
QOT00_RS22265 12150..13265 + 1116 WP_181881134 type II secretion system F family protein -
QOT00_RS22270 13295..13891 + 597 WP_046449666 type 4 pilus major pilin -
QOT00_RS22275 13907..14380 + 474 WP_064575620 lytic transglycosylase domain-containing protein virB1
QOT00_RS22280 14377..14988 + 612 WP_115349496 prepilin peptidase -
QOT00_RS22285 14985..15368 + 384 WP_064575616 hypothetical protein -
QOT00_RS22290 15365..16735 + 1371 WP_064575614 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
QOT00_RS22295 16766..17215 + 450 WP_064575613 DotD/TraH family lipoprotein -
QOT00_RS22300 17212..18036 + 825 WP_064575611 type IV secretory system conjugative DNA transfer family protein traI
QOT00_RS22305 18000..19202 + 1203 WP_223283628 plasmid transfer ATPase TraJ virB11
QOT00_RS22310 19192..19458 + 267 WP_064575607 IcmT/TraK family protein traK
QOT00_RS22315 19470..22892 + 3423 WP_115349497 DUF5710 domain-containing protein -
QOT00_RS22320 22905..23369 + 465 WP_115349498 hypothetical protein traL
QOT00_RS22325 23433..24110 + 678 WP_115349499 DotI/IcmL/TraM family protein traM
QOT00_RS22330 24107..25144 + 1038 WP_115349500 DotH/IcmK family type IV secretion protein traN
QOT00_RS22335 25144..26346 + 1203 WP_064575597 conjugal transfer protein TraO traO
QOT00_RS22340 26343..27098 + 756 WP_064575594 hypothetical protein traP
QOT00_RS22345 27108..27638 + 531 WP_046449679 conjugal transfer protein TraQ traQ
QOT00_RS22350 27654..28052 + 399 WP_046449680 DUF6750 family protein traR
QOT00_RS22355 28116..28724 + 609 WP_064575592 hypothetical protein traT
QOT00_RS22360 28721..31783 + 3063 WP_064575591 hypothetical protein traU
QOT00_RS22365 31801..33021 + 1221 WP_064575587 conjugal transfer protein TraW traW
QOT00_RS22370 33018..33536 + 519 WP_064575580 conjugal transfer protein TraX -
QOT00_RS22375 33587..35734 + 2148 WP_064575578 DotA/TraY family protein traY
QOT00_RS22380 35731..36291 + 561 WP_064575576 hypothetical protein -
QOT00_RS22385 37026..37121 + 96 WP_021542841 DinQ-like type I toxin DqlB -
QOT00_RS22390 37265..38602 + 1338 WP_187989755 conjugal transfer protein TrbA trbA
QOT00_RS22395 38703..39701 + 999 WP_064575574 hypothetical protein trbB
QOT00_RS22400 39688..41883 + 2196 WP_115349501 F-type conjugative transfer protein TrbC -
QOT00_RS22405 42023..42481 + 459 WP_228286841 phospholipase D family protein -
QOT00_RS22410 42527..43507 + 981 WP_032430896 IS5-like element IS5 family transposase -
QOT00_RS22415 43616..43819 - 204 WP_000528119 fumarate hydratase FumD -
QOT00_RS22420 43912..44496 - 585 WP_000974596 tetrathionate respiration response regulator TtrR -

Host bacterium

ID   9083 GenBank   NZ_OX460964
Plasmid name   MIP2461_p1 Incompatibility group   -
Plasmid size   110923 bp Coordinate of oriT [Strand]   73003..73088 [-]
Host baterium   Hafnia paralvei strain MIP2461 isolate MIP2461

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -