Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   108406
Name   oriT_p2-mcr in_silico
Organism   Salmonella enterica strain
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP091575 (14174..14226 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p2-mcr
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   6007 GenBank   WP_065304450
Name   t4cp2_INN74_RS26360_p2-mcr insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73526.12 Da        Isoelectric Point: 9.2491

>WP_065304450.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKTELMNKIARDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 36243..60381

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
INN74_RS26300 (INN74_26300) 31316..32542 - 1227 WP_001672025 RNA-guided endonuclease TnpB family protein -
INN74_RS26305 (INN74_26305) 32601..33005 + 405 WP_001175008 IS200/IS605 family transposase -
INN74_RS26310 (INN74_26310) 34305..35591 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
INN74_RS26315 (INN74_26315) 35604..36239 - 636 WP_000934979 A24 family peptidase -
INN74_RS26320 (INN74_26320) 36243..36725 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
INN74_RS26325 (INN74_26325) 36791..37348 - 558 WP_000095048 type 4 pilus major pilin -
INN74_RS26330 (INN74_26330) 37393..38502 - 1110 WP_000974903 type II secretion system F family protein -
INN74_RS26335 (INN74_26335) 38493..40031 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
INN74_RS26340 (INN74_26340) 40056..40550 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
INN74_RS26345 (INN74_26345) 40534..41844 - 1311 WP_001454111 type 4b pilus protein PilO2 -
INN74_RS26350 (INN74_26350) 41895..43538 - 1644 WP_001035587 PilN family type IVB pilus formation outer membrane protein -
INN74_RS26355 (INN74_26355) 43531..44061 - 531 WP_001220542 sigma 54-interacting transcriptional regulator virb4
INN74_RS26360 (INN74_26360) 44108..46066 - 1959 WP_065304450 type IV secretory system conjugative DNA transfer family protein -
INN74_RS26365 (INN74_26365) 46082..47137 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
INN74_RS26370 (INN74_26370) 47156..48295 - 1140 WP_054173905 TrbI/VirB10 family protein virB10
INN74_RS26375 (INN74_26375) 48285..48986 - 702 WP_049824867 TrbG/VirB9 family P-type conjugative transfer protein -
INN74_RS26380 (INN74_26380) 49052..49786 - 735 WP_000432282 type IV secretion system protein virB8
INN74_RS26385 (INN74_26385) 49786..49920 - 135 WP_000701233 hypothetical protein -
INN74_RS26390 (INN74_26390) 49952..52309 - 2358 WP_065304451 VirB4 family type IV secretion system protein virb4
INN74_RS26395 (INN74_26395) 52315..52635 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
INN74_RS26400 (INN74_26400) 52706..52996 - 291 WP_000865479 conjugal transfer protein -
INN74_RS26405 (INN74_26405) 52996..53580 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
INN74_RS26410 (INN74_26410) 53601..53999 - 399 WP_001153665 hypothetical protein -
INN74_RS26415 (INN74_26415) 54118..54555 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
INN74_RS26420 (INN74_26420) 54561..55796 - 1236 WP_015059538 TcpQ domain-containing protein -
INN74_RS26425 (INN74_26425) 55799..56098 - 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
INN74_RS26430 (INN74_26430) 56166..56447 - 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
INN74_RS26435 (INN74_26435) 56437..56688 - 252 WP_000121741 hypothetical protein -
INN74_RS26440 (INN74_26440) 56788..57423 - 636 WP_015059536 hypothetical protein -
INN74_RS26445 (INN74_26445) 57567..58280 + 714 WP_065304452 DUF5710 domain-containing protein -
INN74_RS26450 (INN74_26450) 58503..58727 - 225 WP_065304445 EexN family lipoprotein -
INN74_RS26455 (INN74_26455) 58736..59380 - 645 WP_065304453 type IV secretion system protein -
INN74_RS26460 (INN74_26460) 59386..60381 - 996 WP_065304446 type IV secretion system protein virB6
INN74_RS26465 (INN74_26465) 60385..60642 - 258 WP_000739144 hypothetical protein -
INN74_RS26470 (INN74_26470) 60639..60941 - 303 WP_065304447 hypothetical protein -
INN74_RS26475 (INN74_26475) 61156..61464 - 309 WP_236492988 hypothetical protein -
INN74_RS26480 (INN74_26480) 61511..61681 - 171 WP_044069355 hypothetical protein -
INN74_RS26485 (INN74_26485) 61685..62128 - 444 WP_071961414 NfeD family protein -
INN74_RS26490 (INN74_26490) 62502..63455 - 954 WP_072089442 SPFH domain-containing protein -
INN74_RS26495 (INN74_26495) 63501..63695 - 195 WP_001127356 DUF1187 family protein -
INN74_RS26500 (INN74_26500) 63688..64140 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   8841 GenBank   NZ_CP091575
Plasmid name   p2-mcr Incompatibility group   IncI2
Plasmid size   65271 bp Coordinate of oriT [Strand]   14174..14226 [-]
Host baterium   Salmonella enterica strain

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -