Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   108323
Name   oriT_SRCM117797|unnamed2 in_silico
Organism   Bacillus subtilis strain SRCM117797
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP125294 (6039..6060 [-], 22 nt)
oriT length   22 nt
IRs (inverted repeats)      1..6, 16..21  (CCCCCC..GGGGGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 22 nt

>oriT_SRCM117797|unnamed2
CCCCCCATGCTAACAGGGGGGT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5565 GenBank   WP_250621201
Name   Mob_Pre_QL281_RS22925_SRCM117797|unnamed2 insolico UniProt ID   _
Length   62 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 62 a.a.        Molecular weight: 7550.47 Da        Isoelectric Point: 10.0270

>WP_250621201.1 plasmid recombination protein [Bacillus subtilis]
MANYAVIRMEKYKKDRLNGTQKHNQREFQKSKNENIDRERTHLNYDLINEKPISYSKAIHEN

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-61)


  Protein structure



No available structure.




Host bacterium

ID   8758 GenBank   NZ_CP125294
Plasmid name   SRCM117797|unnamed2 Incompatibility group   Col
Plasmid size   6375 bp Coordinate of oriT [Strand]   6039..6060 [-]
Host baterium   Bacillus subtilis strain SRCM117797

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -