Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 108248 |
| Name | oriT1_p2_EfsC94_repUS41  |
| Organism | Enterococcus faecalis strain EfsC94 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP124903 (2070..2094 [+], 25 nt) |
| oriT length | 25 nt |
| IRs (inverted repeats) | 1..9, 16..24 (TAAAGTATA..TATACTTTA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 25 nt
>oriT1_p2_EfsC94_repUS41
TAAAGTATAGTGGGTTATACTTTAC
TAAAGTATAGTGGGTTATACTTTAC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 5517 | GenBank | WP_229236143 |
| Name | Mob_Pre_QLQ35_RS14260_p2_EfsC94_repUS41 |
UniProt ID | _ |
| Length | 41 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 41 a.a. Molecular weight: 5019.54 Da Isoelectric Point: 8.4734
>WP_229236143.1 MULTISPECIES: plasmid recombination protein [Lactobacillales]
MSRSHLNYDLVDRTYNYKTDIERYINENKSSPRAIRNKDEL
MSRSHLNYDLVDRTYNYKTDIERYINENKSSPRAIRNKDEL
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 8683 | GenBank | NZ_CP124903 |
| Plasmid name | p2_EfsC94_repUS41 | Incompatibility group | - |
| Plasmid size | 13517 bp | Coordinate of oriT [Strand] | 2070..2094 [+]; 13088..13123 [-] |
| Host baterium | Enterococcus faecalis strain EfsC94 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |