Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   108246
Name   oriT_p1_EfsPNK7_rep7a in_silico
Organism   Enterococcus faecalis strain EfsPNK7
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP124888 (32970..32992 [-], 23 nt)
oriT length   23 nt
IRs (inverted repeats)     _
Location of nic site      12..13
Conserved sequence flanking the
  nic site    		  GTGTGTTATA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 23 nt

>oriT_p1_EfsPNK7_rep7a
AAGTCTAGTGTGTTATACTTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5515 GenBank   WP_002360778
Name   Replic_Relax_QLQ46_RS13970_p1_EfsPNK7_rep7a insolico UniProt ID   E3WD80
Length   261 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 261 a.a.        Molecular weight: 31521.56 Da        Isoelectric Point: 7.7925

>WP_002360778.1 MULTISPECIES: replication-relaxation family protein [Bacteria]
MKPLLYNYFIDYSKEDKIHLILLCLLHELRVVSVKQLIDFCQFDNMAKKSSVYGNLKKLKEKNLVECSQI
GLTKFYYLTKEGHNYIGGYYTLPKVPEYNLQHHLQINDYLIKMLELCNNHPHLKAVVSERRKVYEVKDEK
KNQKGVKYFVPDFIFMFLDSIGREVEWQFEIELTLKTKRRYSQGVFPKYIKHLKNYEDARLIYVTPSSII
KEELDMFKEYFIDKEGDEYKEVFDRLHVFSAEEFESELKRLLEKDKFINWE

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB E3WD80


Host bacterium

ID   8681 GenBank   NZ_CP124888
Plasmid name   p1_EfsPNK7_rep7a Incompatibility group   -
Plasmid size   69286 bp Coordinate of oriT [Strand]   32970..32992 [-]
Host baterium   Enterococcus faecalis strain EfsPNK7

Cargo genes

Drug resistance gene   str, dfrG
Virulence gene   prgB/asc10
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21, AcrIIA9