Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   107984
Name   oriT_pLC71A in_silico
Organism   Lactococcus cremoris strain 7-1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_AP025521 (38801..38838 [-], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      1..9, 17..25  (ACACCACCC..GGGTGGTGT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 38 nt

>oriT_pLC71A
ACACCACCCATTTTTGGGGTGGTGTGTAAGTGCGCATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5356 GenBank   WP_248537006
Name   mobQ_Llc71_RS13335_pLC71A insolico UniProt ID   _
Length   680 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 680 a.a.        Molecular weight: 79299.46 Da        Isoelectric Point: 6.6679

>WP_248537006.1 MobQ family relaxase [Lactococcus cremoris]
MAIFHMNFSNISAGKGRSAVASASYRSGEKLYSEMENKTYFYDRSVMPESFILLPENAPEWAKDRQKLWN
EVEAIDRKVNSRYAKEFNVALPIELSEDEQKELLTEYVQKTFVDKGMVADVAIHRDHDENPHAHVMLTNR
PFNADGSWGQKSKKEYILDENGNKTYTAKGNARSRKIWLVDWDKVGKVEEWRKAWADHVNSVFQEKKIDE
RISEKTLEAQGINDIATQHVGVTGNRDERAEFNELVLENRQHKAELENLNEKINNELKVKQLKNFYSFNE
KKVIAELSKELHTFIDLEHLEEKNKMLFNWKNSVLIKQIVGKDVSEELNKVSRQEFSLDNANRLIDKVVD
RSIKAMYPTVDSNAFSMPEKRQLIRETESENKVFTGAELDDRLSMIRADSLNRQIVALTKRPFTSLTMLS
KQEKYHIDNINNVLAYQGYNYENIEMSHGKILRNYESEEFSKELDIIQRSLKQINSIEEVRKIVEQQYSV
VLGTIFPDSELNKLSLVEKEKTYNAVIYFNPTIKKLTQSELENIVKEPPILFSTKEHNQGLSYLAGRIRL
EDINNKHLTRVLKFEGTKKLFIGEAKADKNIDPELLKEATNRNDKQSYKNEFYRDKNMENYQSVAYSDTS
PAEYMNRLFSGVLISVLYNNENQHKKGLEEVEWDMERKHREHTKTGGLSR

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(17-237)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(276-383)


  Protein structure



No available structure.




T4CP

ID   5646 GenBank   WP_010890635
Name   t4cp2_Llc71_RS13395_pLC71A insolico UniProt ID   _
Length   530 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 530 a.a.        Molecular weight: 59615.30 Da        Isoelectric Point: 4.8001

>WP_010890635.1 MULTISPECIES: VirD4-like conjugal transfer protein, CD1115 family [Lactococcus]
MNGTILGVLDNKIIYQDNTTKPNRNVMVIGGSGSYKTQSVVITNLFNETKNSIVVTDPKGELYEKTAGIK
LAQGYEVHVVNFANMAHSDRYNPFDYIERDIQAESVATKIVQSENAEGKKDVWFSTQRQLLKALILFVMK
ERSPEQRNLAGVINVLQTFDSEPINKDENSDLDNLFLALKITHPARIAYELGFKKAKGDMKASIISSLLA
TISKFTDEEVSNFTSISDFHLQDIGRKKIVLYVIIPVMDNTYESFINLFFSQMFDELYKLASSNGAKLPQ
EVDFILDEFVNLGKFPKYEEFLATCRGYGIGVTTICQTLTQLQSLYGKEKAESILGNHAVKICLNASNEA
TAKYFSELLGKSTVKVETGSESTSHSKETSTSKSDSYSYTSRQLMTPDEIIRMPDTQSLLIFTNQKPIKA
TKAFQFKLFPDADSKVKLEQNKYVGITSKSQLEKYNDLSVKWEEKLQSLKNITVTEEEEKDLQDNIDSDL
EAMNNENSGVDNSTTETDKIAETEAKEVQAEEKNFDQVVL

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(25-452)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 34020..52253

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Llc71_RS13265 (Llc71_26260) 29581..29931 + 351 WP_023349076 hypothetical protein -
Llc71_RS13895 30038..30124 - 87 Protein_27 IS3 family transposase -
Llc71_RS13270 (Llc71_26270) 30138..30398 + 261 Protein_28 recombinase family protein -
Llc71_RS13275 (Llc71_26280) 30581..31567 - 987 WP_058147809 UDP-glucose 4-epimerase GalE -
Llc71_RS13280 (Llc71_26290) 31651..31959 + 309 Protein_30 recombinase family protein -
Llc71_RS13285 (Llc71_26300) 32063..32860 + 798 WP_248537002 ParA family protein -
Llc71_RS13290 (Llc71_26310) 32874..33140 + 267 WP_010890679 hypothetical protein -
Llc71_RS13295 33235..33600 + 366 WP_042748662 hypothetical protein -
Llc71_RS13300 (Llc71_26320) 33614..33994 + 381 WP_010890681 single-stranded DNA-binding protein -
Llc71_RS13305 (Llc71_26330) 34020..34964 + 945 WP_010890682 toprim domain-containing protein traP
Llc71_RS13310 (Llc71_26340) 35636..36790 + 1155 WP_010890657 RepB family plasmid replication initiator protein -
Llc71_RS13315 (Llc71_26350) 37267..37584 + 318 WP_248537003 hypothetical protein -
Llc71_RS13320 (Llc71_26360) 37599..37799 + 201 WP_058147838 hypothetical protein -
Llc71_RS13325 (Llc71_26370) 38089..38355 - 267 WP_248537004 hypothetical protein -
Llc71_RS13330 (Llc71_26380) 38368..38652 - 285 WP_248537005 hypothetical protein -
Llc71_RS13335 (Llc71_26390) 38921..40963 + 2043 WP_248537006 MobQ family relaxase -
Llc71_RS13340 (Llc71_26400) 41048..41392 + 345 WP_010890662 hypothetical protein -
Llc71_RS13345 (Llc71_26410) 41393..41998 + 606 WP_248537007 hypothetical protein -
Llc71_RS13350 (Llc71_26420) 42011..42355 + 345 WP_010890627 CagC family type IV secretion system protein -
Llc71_RS13355 (Llc71_26430) 42376..42723 + 348 WP_010890628 hypothetical protein trsC
Llc71_RS13360 (Llc71_26440) 42707..43360 + 654 WP_010890629 TrsD/TraD family conjugative transfer protein trsD
Llc71_RS13365 (Llc71_26450) 43372..45390 + 2019 WP_010890630 DUF87 domain-containing protein virb4
Llc71_RS13370 (Llc71_26460) 45383..46801 + 1419 WP_042748760 type VII secretion protein EssB/YukC -
Llc71_RS13375 (Llc71_26470) 46803..47960 + 1158 WP_010890632 phage tail tip lysozyme prgK
Llc71_RS13380 (Llc71_26480) 47973..48590 + 618 WP_010890664 hypothetical protein -
Llc71_RS13385 (Llc71_26490) 48580..48948 + 369 WP_010890633 hypothetical protein -
Llc71_RS13390 (Llc71_26500) 48945..49403 + 459 WP_010890634 hypothetical protein trsJ
Llc71_RS13395 (Llc71_26510) 49400..50992 + 1593 WP_010890635 VirD4-like conjugal transfer protein, CD1115 family -
Llc71_RS13400 (Llc71_26520) 51007..51402 + 396 WP_010890665 hypothetical protein -
Llc71_RS13405 (Llc71_26530) 51417..52253 + 837 WP_010890636 conjugal transfer protein TrbL family protein trsL
Llc71_RS13410 (Llc71_26540) 52269..54446 + 2178 WP_042748761 type IA DNA topoisomerase -
Llc71_RS13415 (Llc71_26550) 54449..54658 + 210 WP_010890684 hypothetical protein -
Llc71_RS13420 (Llc71_26560) 54661..55728 + 1068 WP_010890638 ArdC family protein -
Llc71_RS13425 (Llc71_26570) 56146..56826 - 681 WP_075070723 IS6-like element ISS1N family transposase -

Host bacterium

ID   8419 GenBank   NZ_AP025521
Plasmid name   pLC71A Incompatibility group   -
Plasmid size   98383 bp Coordinate of oriT [Strand]   38801..38838 [-]
Host baterium   Lactococcus cremoris strain 7-1

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -